KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329098
Entry
4329098           CDS       T01015                                 
Name
(RefSeq) tyrosine aminotransferase isoform X1
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00270  Cysteine and methionine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00034  Methionine salvage pathway
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4329098
   00350 Tyrosine metabolism
    4329098
   00360 Phenylalanine metabolism
    4329098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4329098
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329098
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4329098
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4329098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4329098
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     4329098
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4329098
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_3
Other DBs
NCBI-GeneID: 4329098
NCBI-ProteinID: XP_015625983
UniProt: G4LTY9 Q6K4T7
LinkDB
Position
2:11716852..11736549
AA seq 430 aa
MESGGAGGEGETAGWRFGAANPALAVAGSQSIRAAVTRIYRCLDGSGDARPVAPLAHGDP
SAFACFRAAPAATDAVAAAAASGKYNYYSPAVGIAPACSAVAAHLSRELPYAVSPADVVL
TAGCNHAVEIMMSVLASPGANVLLPRPGYPLYASRAALSGLEFRHFDLLPDSEWEVDLAG
VEALADANTVAMVIVNPNNPCGCVYSRDHLAKIAETARKLGIMVISDEVYDHFAFGSKPF
VPMGVFGDVAPVMTLGGISKRWMVPGWRLGWIAATDPNGILRNKKIIDSVIDYRAISVDP
VTFVQGALPDILAKTDDAFFTNALGVVKKAAEICYEKLKEIDCITCPHKPEGSMFVMAKL
DLSSLDGIEDDVDFCSKLAKEESVVICPGSGLGMKNWLRITFAVDPQLLEDGLERTKCFC
KRHGKIKEAS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagagcggcggcgccggcggcgaaggcgagacggcggggtggcggttcggcgcggcg
aacccggcgctggcggtggcggggtcgcagagcatccgcgcggccgtgacacggatttac
cgctgcctcgacgggagcggcgacgcgcggcccgtggcgccactcgcccacggcgacccc
tccgcgttcgcgtgcttccgcgccgcgcccgccgccacggacgccgtcgccgccgctgcc
gcctccggcaagtacaactactactcccccgccgtaggaatcgccccggcgtgcagcgcg
gtggcggcgcacctgtcgcgggagctcccctacgccgtctcgccggcggacgtggtgctc
accgccggctgcaaccacgccgtcgagatcatgatgtccgtgctcgcgtcgccgggcgcc
aacgtgctgctcccgcggcccggctacccgctgtacgcgtcgcgcgccgccctgagcggc
ctcgagttccgccacttcgacctcctccccgacagcgagtgggaggtcgacctcgccggc
gtcgaggccctcgccgacgccaacaccgtcgccatggtcatcgtcaaccccaacaacccc
tgcggctgcgtctactcccgcgaccacctcgccaagatcgcagagacggcgaggaagctg
gggataatggtgatcagcgacgaggtgtacgaccacttcgcgttcgggagcaagccgttc
gtgccgatgggggtgttcggcgacgtggcgccggtgatgacgctgggcggcatctccaag
cggtggatggtgcccggctggcgcctcggctggatcgccgccaccgatcccaacggaatc
ctcaggaacaagaagatcatcgactcagtcattgactaccgagccatctcggtagatccc
gtaacatttgttcagggagcattgcccgacatcctcgcgaagacggacgatgcgttcttc
accaatgcccttggggtggtgaagaaggcggcggagatatgctacgagaagctcaaggag
atcgactgcatcacctgccctcacaagccggagggctccatgttcgtcatggcgaagctg
gacctgtcttccctagatggcatagaggacgacgtcgacttctgcagcaagctggccaag
gaggaatccgtggtcatctgcccagggagtggattagggatgaagaattggctccggata
accttcgcggttgatccacaattactagaggatggtctagagagaaccaagtgtttctgc
aagaggcatggtaaaatcaaggaagccagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329101
Entry
4329101           CDS       T01015                                 
Name
(RefSeq) probable aminotransferase TAT2
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00270  Cysteine and methionine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00034  Methionine salvage pathway
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4329101
   00350 Tyrosine metabolism
    4329101
   00360 Phenylalanine metabolism
    4329101
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4329101
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329101
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4329101
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4329101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4329101
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     4329101
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4329101
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 4329101
NCBI-ProteinID: XP_015623362
UniProt: A0A0P0VI38 Q6K5U4
LinkDB
Position
2:11749085..11753798
AA seq 469 aa
MGRIYFHFCSPSKRTNLDKPLEERHPIELTMEGVGGGKRRGDDGAEATPRWRFSRPSSQG
GPLAAAGLTSIRAVLNRVNSSVDAAAAGGPRPVLRLGNGDPTASACYRTAPAAEDAVVDA
LRSGAHNGYSLTVGVLSARRAIAEYLSRDLPYELSANDIYLTSGCVQAIEVMISVLAQPG
SNILLPKPGFPLYESRTTFSNLEVRHFDLIPERGWEVDLEGVQAIADENTVAIVVINPSN
PCGSVYSYDHLAKIAETARKLGLLIIADEVYDHLAFGNNPFIPIGVFGKTVPVITLGSIS
KRWLVPGWRLGWIATCDPNGILKEAKVNQSIENYINISTDPATFVQGAIPQIIANTKEDY
FNKILDQLRNAADLCYDKIKDIKGITCPHKPEGSMFVMVKLDLSYLDGFHDDMDFCCRLA
KEESVIVLPGSALGLKNWVRITFAIDIPSLVDAFERIKSFCQRHGKLET
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggggagaatatatttccatttttgttcaccttcgaaacgaacaaatttggataaaccg
ctcgaagagcggcatccgatcgagctaacaatggagggtgtcggtggcggcaagcgccgc
ggggacgacggggcggaggccacgccgcggtggcgcttctcccggccgtcgtcgcagggc
gggcccctggcggccgccggcctcacgagcatccgcgcggtgctcaaccgcgtcaactcc
tccgtcgacgccgccgccgccggcgggccgcgccccgtcctgcggctcggcaacggcgac
cccaccgcgtccgcctgctaccgcaccgcgcccgccgccgaggacgccgtcgtcgacgcg
ctccgctccggggcgcacaacggctactccctaaccgtcggcgtcctctcggcgcgccgt
gctattgcagaatacctatctcgagatcttccttatgagctttcggcaaatgatatttac
ctgacctccggatgtgtccaagcgatcgaagtcatgatctctgttttggctcagcccgga
tccaacatcttacttcccaaacccggctttccattgtatgaatcacggactacattcagc
aatctagaggttcgacatttcgatctcattccagagagaggctgggaggtagacctagag
ggtgtgcaagctattgctgatgagaacactgttgcaattgtcgtgatcaatcccagtaac
ccttgtggaagcgtgtattcgtatgatcatttggcaaaaattgccgagaccgccaggaaa
cttggtttgctgataattgctgatgaggtatatgaccatttggcatttgggaataatcct
tttatacctattggtgtttttgggaagaccgtcccagtgatcaccttgggatctatttca
aaaagatggcttgtacctggttggcgacttggttggatagcaacatgtgatccaaatggc
attttaaaggaagccaaggttaaccaatcaattgagaactatattaacatctcaactgat
cctgcaacgtttgttcagggagcaatccctcaaattatagccaacacaaaagaagattac
ttcaacaaaattctcgatcaattaaggaatgcagcggatttatgttatgataaaataaag
gacatcaagggcattacatgtccacacaagccagagggatcaatgtttgtgatggtaaaa
ttggatctctcttacttggatggcttccatgatgatatggacttctgctgcaggttggca
aaagaggagtctgtgatagttttgccagggagtgcattaggattgaagaattgggttcgc
atcactttcgccatcgatataccatctcttgtggatgcctttgaaaggataaaatctttc
tgccagaggcatggcaaactggaaacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340970
Entry
4340970           CDS       T01015                                 
Name
(RefSeq) nicotianamine aminotransferase A isoform X1
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00270  Cysteine and methionine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00034  Methionine salvage pathway
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4340970
   00350 Tyrosine metabolism
    4340970
   00360 Phenylalanine metabolism
    4340970
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4340970
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4340970
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4340970
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4340970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4340970
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     4340970
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4340970
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 4340970
NCBI-ProteinID: XP_015641108
UniProt: Q5Z7R3 Q0DCD0
LinkDB
Position
6:13835574..13844011
AA seq 441 aa
MEGGRGGKRWRFATPNLAVAAAGERSIQRYLLQLHACLDENGPRPVIPLSHGDPSSSACF
RTAPEAEEAVAAAVRSGDYNGYSSPATSLPARRAIAEYLSCDLPYKLCTDDIFLTSGGTQ
AIEIVMSVFGQPGANILLPKPGYPKHEAHAVFHRMEVRLYDLVPERGWEINVEAVEALAD
ENTVAIVITNPNNPCGNVYTYEHLSKIADTASKFGLLVIADEVYGHLVYGSTPFVPMGVF
GETVPVLTLGAISKRWVVPGWRFGWIAICDPKGILKETKVVDSLRSFRNLTTGPATFIQG
AIPHIMKNTNDEFFRKTLELLKETAEICFGEIKEIKCITCPHKPEGSFFMMVKLDISQLS
DICDDIDFCSKLVKEESVVLLPGRALGMENWLRITFALDPPRLKQGLERVKSFCRRHQSH
ANMLNISASAKVEPHFGMSKS
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggagggcggccgcggggggaagcgatggcgcttcgcgaccccgaatctggccgtggcc
gcggccggggaacgcagcatccagcggtacctccttcagctgcacgcgtgcctggacgag
aacgggccacggcccgtcatcccgctcagccacggcgacccttcctcctccgcctgcttc
cgcaccgcgcccgaggcagaggaagccgtcgccgccgccgtccgctccggcgactacaac
ggctactcctcccccgccaccagcctccctgctcgccgagctattgcagagtacctatcc
tgtgatcttccttacaagctttgcacagatgatattttcctcacatctggaggtacccaa
gcaatcgagattgttatgtctgtttttggccaaccaggtgccaatatattgcttccaaag
cccgggtacccaaaacatgaagcacatgcggtgttccacaggatggaagtgcggctctat
gatcttgttccagagagaggatgggagattaatgttgaagctgttgaagctttagcagat
gagaatactgttgcaatagtgattactaaccccaataacccttgtggtaatgtgtacact
tatgagcatctgtccaagattgcagatacagcaagcaagttcggtctgttagtcattgct
gatgaagtatatggtcaccttgtttatggaagcactccttttgtgccaatgggtgtgttt
ggagagactgttccagtactcacattgggagctatatcaaagagatgggttgtccctggc
tggagatttggatggatagcaatttgtgatcctaaaggcattctgaaagaaacaaaggtc
gtcgattcactcagaagctttcgaaacctaacaacaggtcctgcaacatttattcaggga
gctattcctcatattatgaagaacacaaatgatgaattcttcagaaagactctcgagttg
ttaaaggaaactgctgagatatgttttggtgaaataaaagaaataaagtgtatcacctgt
cctcacaaacctgaggggtcgttttttatgatggtaaaacttgatatatcacaattatcg
gacatttgtgacgacatcgatttctgcagcaagttggtaaaggaggagtctgtcgtactt
ttgcctgggagagccttaggcatggaaaactggttgcgcatcacctttgcattggatccc
ccaaggctaaagcaaggattagaaagggtcaagtccttttgccggaggcatcagtcacat
gctaatatgctcaatataagtgcgtcggcgaaagtggagccccatttcggaatgtcaaag
agttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350712
Entry
4350712           CDS       T01015                                 
Name
(RefSeq) probable aminotransferase TAT2
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00270  Cysteine and methionine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00034  Methionine salvage pathway
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4350712
   00350 Tyrosine metabolism
    4350712
   00360 Phenylalanine metabolism
    4350712
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4350712
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4350712
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4350712
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4350712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4350712
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     4350712
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4350712
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Aminotran_3 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 4350712
NCBI-ProteinID: XP_015615606
LinkDB
Position
11:complement(20525549..20529363)
AA seq 442 aa
MEDGSGNGRPPATAAAWNFEPNGALLGLTALSVRGVLGRVKAGMAAGGGGDGGGGGGRAV
IPMGHGDPSVFPCFRTTADAVDAVAAALRSGEHNSYSSCVGLEPARRSIARYLSRDLPYE
LSADDVYLTSGCAQAIEIICSVLARPGANILCPRPGYLFHEARAVFNGMEVRYFDLLPES
GWEVDLDGVQELADKNTVAMVIINPGNPCGNVYTSEHLAKVAETAKKLGIFVIADEVYAH
LTFGQNKFVPMGVFGSVAPVLTLGSISKRWVVPGWRLGWIVTSDPNGVFQRTKVVESIQS
YLDISADPATFIQGAIPQLIENTKEEFFEKTVDVLRQTADICWEKLKGISCITCPSKPEG
SMFVMVKLDLSCLQGIKDDMDFCCQLAKEELVILLPGCAVGYKNWLRITFAIEPSSLEDG
IDRLKSFCSRHSKPKVHRSLET
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggaggacggctccggcaacgggcggccgccggccaccgcggcggcgtggaacttcgag
ccgaacggcgcgctgctcgggctgacggcgctgtcggtgcgcggcgtgctgggcagggtc
aaggccgggatggcggcgggcggcggcggagatggtggtggtggtggtgggcgggcggtg
atcccgatgggacacggcgacccgtcggtgttcccgtgcttccggacgacggcggacgcc
gtggacgccgtggcggcggcgctccggtccggggagcacaactcctactcctcctgcgtc
ggcctcgagcctgcacggaggtctatcgcgcggtacttatcgcgagacttgccatatgag
ctatcagctgatgatgtgtacctgacaagtggctgtgctcaagcgattgagatcatctgc
tctgtcctagctcgccctggtgccaacatcctgtgcccaaggccagggtacctgttccac
gaggcacgcgcagtgttcaatggcatggaggtcaggtactttgatcttctcccagagagt
ggctgggaggttgatcttgatggagtgcaggaacttgctgacaagaacacggttgcaatg
gtcattatcaatccaggaaatccctgtggcaatgtctacacttctgagcatttggccaag
gttgccgagaccgcgaaaaagcttggcatctttgtcattgcagatgaagtgtatgcacat
ttgacgtttgggcagaataaatttgtgccgatgggggtgtttggctcagtagctccagtt
cttacgttaggatcgatatcgaagagatgggttgtgcctggatggcgacttggatggatt
gtgacgagcgatcctaatggcgtatttcaaaggaccaaggtagtggaaagcatccagagt
taccttgatatctcggctgatcctgcaacatttatccagggagcaattccacaactcata
gagaacacaaaggaagaattcttcgaaaagaccgtcgatgtcctaaggcagaccgcagat
atttgttgggagaagctgaagggcatcagttgcatcacttgcccaagcaaacctgagggt
tccatgtttgtcatggtgaaactggatctgtcctgcctgcaaggcatcaaagatgacatg
gacttctgctgccagctagcaaaggaagaattggtgattcttttgccaggatgtgctgtt
ggatacaagaattggctccgaatcaccttcgccatcgaaccgtcttctcttgaagatggt
attgataggctcaagtccttctgctcgcgacatagcaagccgaaagttcaccggtctctt
gaaacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351017
Entry
4351017           CDS       T01015                                 
Name
(RefSeq) probable aminotransferase TAT2
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00270  Cysteine and methionine metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00034  Methionine salvage pathway
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4351017
   00350 Tyrosine metabolism
    4351017
   00360 Phenylalanine metabolism
    4351017
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4351017
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4351017
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4351017
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4351017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4351017
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     4351017
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4351017
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase
Other DBs
NCBI-GeneID: 4351017
NCBI-ProteinID: XP_015615214
UniProt: G4LTZ2
LinkDB
Position
11:complement(25596437..25602453)
AA seq 452 aa
MAPTAEVAAAPVQEQEKCNGGGGGGFRGAAVRCHPALSTEKKASIRGVVGELLGAAAAAA
GAGEERRRSLISLGVGDASSHACFRRGGEFAADAVADAARSGVFDCYAPSCGFPAARRAV
ADHLSAGARHRTRDADVFMTAGGTGAITAIATVLGGAPGANVLLPRPGFAPYEAACELAG
AEPRFYDLLPRRGWEADLAGVRAMADGATAAIVVINPNNPCGAVYSAQHLFQIAETAREL
GIPIIADEVYAHMVFGGSKFVPMATFAHITPVITIGALSKKFMLPGWRLGWLAFCDPNGA
LKHVRNATEMLLNVTSGPASIVQAAVPKILSNEHNEFHRNVVNLLESAADALYRRVNQIE
ALQCYSKPHGSMFMMVEVNTSLLFGVEDDMDFARELIKEESVLVLPGSVIGLKNWIRIFF
GAPTSVILEACDRIEAFCQKRAVQVKLLKKKF
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggctccaactgcagaggttgcggcggcgccggtgcaggagcaggagaaatgcaacggc
ggcggcggaggcgggtttaggggtgcggcggtgaggtgccacccggcgctgtcgacggag
aagaaggcgtcgatcaggggcgtcgtcggggagctgctcggtgctgcggcggcggcggcc
ggcgccggcgaggagaggaggaggagcctcatctcgctcggcgtcggcgacgcgtcctcg
cacgcctgcttcaggcgcggcggcgagttcgcggccgacgccgtcgccgacgcggccagg
tccggggtgttcgactgctacgcgccgtcgtgcggcttcccggccgctcgccgcgccgtc
gccgaccacctgtccgccggcgcgcgccaccgcacccgcgacgccgacgtgttcatgacg
gccggcggcacgggcgcgatcaccgcgatcgcgacggtgctcggcggcgcgccgggggcg
aacgtcctgctgccgcggccgggcttcgcgccgtacgaggcggcctgtgagctcgccggc
gccgagccgcggttctacgacctcctgccgcggcggggctgggaggccgacctcgccggc
gttcgcgccatggccgacggcgcgacggcggccatcgtcgtcatcaaccccaacaatccc
tgcggcgcggtgtactctgcacagcacctttttcagattgctgaaacagcgagagaattg
gggatcccaatcatagcagatgaggtgtatgcacatatggtgtttggtgggagcaagttt
gtgccaatggctacctttgcacatatcacaccagtaatcaccattggagcactatcaaag
aaattcatgctgccaggatggcgacttggttggttggccttctgtgaccccaatggtgca
ctcaagcatgtcagaaatgcaacagaaatgctactgaatgtgacttcaggccctgcctcc
atagttcaggctgcagttcctaagattctctcaaacgaacacaatgaattccatcgaaac
gttgtgaacttgcttgagtctgcagctgatgctctctacagaagagtgaaccagattgaa
gctctgcagtgctactcaaaacctcatggctccatgttcatgatggttgaagtcaacact
tcacttctgttcggtgttgaagatgacatggacttcgctcgtgaattgattaaagaagaa
tctgtcctagttttacctggttctgtaattgggttaaagaactggattaggatattcttt
ggggcacctactagtgtgatacttgaagcctgtgataggattgaagcattctgccaaaaa
agagcagttcaagtaaagctactgaaaaagaagttctga

DBGET integrated database retrieval system