KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329112
Entry
4329112           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4329112 isoform X1
  KO
K08507  unconventional SNARE in the endoplasmic reticulum protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4329112
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329112
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Use1
    4329112
SSDB
Motif
Pfam: Use1 BORCS6 LMBR1
Other DBs
NCBI-GeneID: 4329112
NCBI-ProteinID: XP_015625914
LinkDB
Position
2:11970564..11973645
AA seq 238 aa
MVLSKVEVNLIRLLEAAPRQQNQTKLVHYVTTARELLEQLGSETTPEGISSVSKAKTSEY
SEKIEALAARLAAPEPENEMPVDENREVESSYEGDKPGSPISLSSGLRRRPIAHNVVGPS
SHERKDRDIGAPIKLDEEAQAHIEKHRKLQEDLTDEMVELARQLKESSLTMHQSVQETEK
ILDSTERAVEHSLASTGRATTRAAEVYSLASKTTCFQWLLIFMMTCMFIMVVLLIRVT
NT seq 717 nt   +upstreamnt  +downstreamnt
atggtgcttagcaaggttgaagtgaacttgataaggctgcttgaggcagctcctcgacag
cagaaccagactaagcttgtccattatgtaaccacagccagggaactgttggagcagcta
ggatcagaaactactccagaagggatatcaagtgtatcaaaagctaagacaagtgagtat
tcagaaaagattgaagcattggctgcccggcttgctgctccagagccagaaaatgaaatg
ccagttgatgagaatagagaggtagaaagctcttatgaaggagataagccaggaagtcca
atatcattatcatcaggattacgtaggagaccaatagctcacaacgttgttggacctagc
agtcatgagagaaaagacagagacattggagcacctattaaattggatgaagaagcacag
gctcatattgagaagcataggaagctgcaagaagatctgactgacgaaatggttgagtta
gcgcgccaactgaaagagagcagtctcaccatgcaccaatctgttcaagaaacagagaag
atccttgattccaccgagagagctgtcgagcatagcttggcgagcactgggcgtgcaacc
acgcgagcggcagaggtatactcgctggcttccaagacgacatgcttccagtggctgctc
atcttcatgatgacctgcatgttcattatggtggttctgctcatccgggtcacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346146
Entry
4346146           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4346146 isoform X1
  KO
K08507  unconventional SNARE in the endoplasmic reticulum protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4346146
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346146
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Use1
    4346146
SSDB
Motif
Pfam: Use1 BORCS6
Other DBs
NCBI-GeneID: 4346146
NCBI-ProteinID: XP_015650000
LinkDB
Position
8:26606414..26609538
AA seq 342 aa
MFEGLKIDLFLIGIPYRPNRSCNTQSSLLWSIGFPFAGIRSSRPPPPSAGRFPFAAGSKI
RRRGLVGICPHPWTRLAPLLIAPPRVDALRAASSHKYVTTARELLEQLGAETTPEGISSV
SKAKISEYSEKIEALAARLAVPEHMVYFVFSSNKINLLFRTCSHNNSYRLYFSLIFFVQP
ENEVPVDENREVESSYEGEKPGSPISLSSGLRRRPIAHTDVGPSSHARKDRDIGAPIKLD
AEAQAHIEKHRKLQEDLTDEMVELARQLKESSLTMHQSVQETEKILDSTERAVEHSLAST
GRAATRAAEVYSLASKTTCFQWLLIFMMTCMFIMVVLLIRVT
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtttgagggacttaaaatagacttattcctaatcggaatcccgtatcggcccaacaga
agttgcaatacccagtcatccctcctctggtcgattggattccccttcgctggcatccgc
tcgtccagaccaccgccgccgtccgccggccgcttccccttcgccgccgggagcaagatc
aggcggcgggggctcgtcgggatctgcccccatccatggactcgcttggcgccgcttctg
attgctccgcctcgcgttgatgcgctgcgcgcggcatcgagccacaagtatgtaaccaca
gccagggaattgttggagcagctaggagcagaaactactccagaagggatatcaagtgta
tcaaaagctaagataagtgagtattcagaaaagattgaagcattggctgcccggcttgct
gttccagagcatatggtttactttgttttttcttcaaacaaaatcaacttacttttcaga
acatgcagccacaataactcatatagattatacttttcattgattttttttgttcagcca
gaaaatgaagtgccagttgatgagaatagagaggtagaaagctcttatgaaggagaaaag
ccaggaagtccaatatcattatcatcaggattacgtaggagaccaatagctcacaccgat
gttggacctagcagtcatgcgagaaaggatagagacattggagcacctattaaattggat
gcagaagcgcaggctcacattgagaagcataggaagctacaagaagatctgactgacgaa
atggttgagttagcacgccaactgaaagagagcagtctcaccatgcaccaatctgttcaa
gaaacagagaagatccttgattccaccgagagagctgttgagcatagcttggcgagcact
gggcgtgcagccacgcgagcagcagaggtgtactcgttggcttccaagacgacatgcttc
cagtggctgctcatcttcatgatgacatgcatgttcattatggtggttttgctcatccgg
gtcacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271609
Entry
9271609           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC9271609 isoform X1
  KO
K08507  unconventional SNARE in the endoplasmic reticulum protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9271609
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9271609
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Use1
    9271609
SSDB
Motif
Pfam: Use1 BORCS6 LMBR1
Other DBs
NCBI-GeneID: 9271609
NCBI-ProteinID: XP_015650004
LinkDB
Position
8:26658479..26661536
AA seq 238 aa
MVLSKVEVNLIRLLEAAPRQQNQTKLVHYVTTARELLEQLGSETTLEGISSVSKAKTSEY
SEKIEALAARLAAPEPENEMPVDENREVESSYEGDKPGSPISLSSGLRRRPIAHNVVGPS
SHERKDRDIGAPIKLDEEAQAHIEKHRKLQEDLTDEMVELARQLKESSLTMHQSVQETEK
ILDSTERAVEHSLASTGRATTRAAEVYSLASKTTCFQWLLIFMMTCMFIMVVLLIRVT
NT seq 717 nt   +upstreamnt  +downstreamnt
atggtgcttagcaaggttgaagtgaacttgataaggctgcttgaggcagctcctcgacag
cagaaccagactaagcttgtccattatgtaaccacagccagggaactgttggagcagcta
ggatcagaaactactctagaagggatatcaagtgtatcaaaagctaagacaagtgagtat
tcagaaaagattgaagcattggctgcccggcttgctgctccagagccagaaaatgaaatg
ccagttgatgagaatagagaggtagaaagctcttatgaaggagataagccaggaagtcca
atatcattatcatcaggattacgtaggagaccaatagctcacaacgttgttggacctagc
agtcatgagagaaaagacagagacattggagcacctattaaattggatgaagaagcacag
gctcatattgagaagcataggaagctgcaagaagatctgactgacgaaatggttgagtta
gcgcgccaactgaaagagagcagtctcaccatgcaccaatctgttcaagaaacagagaag
atccttgattccaccgagagagctgtcgagcatagcttggcgagcactgggcgtgcaacc
acgcgagcagcagaggtatactcgttggcttccaagacgacatgcttccagtggctgctc
atcttcatgatgacctgcatgttcattatggtggttctgctcatccgggtcacctaa

DBGET integrated database retrieval system