KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329228
Entry
4329228           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 45 homolog
  KO
K12479  vacuolar protein sorting-associated protein 45
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4329228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329228
Membrane trafficking [BR:osa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    4329228
SSDB
Motif
Pfam: Sec1 KH_9
Other DBs
NCBI-GeneID: 4329228
NCBI-ProteinID: XP_015626420
UniProt: A0A0P0VIH2
LinkDB
Position
2:complement(13977650..13987425)
AA seq 567 aa
MTLITLIRDYIDRMLHDIPGMKVLVLDPDTVGMVSVVYSQSDLLRKEVFLVETVDNASSS
RESMAHLKAVYFLRPSSDNVQKLRRHLAAPRFAEYHLFFSNVLKIPQIQVLADSDEQEVV
QQVQEFYADFCAIDPYHFTLNIRNNHVYMLPMVVDPPGMQSFCDRAVDGIASVFLALKRR
PVIRYQRTSDVAKRIAQETARLMYEQESGLFDFRRTENSSLLLVIDRRDDPVTPLLNQWT
YQAMVHELIGIENNKVDLREYPNVPKDQKEVVLSSVQDEFFRANMFENFGDLGMNIKRMV
DDFQHLSKTSQNIQSISDMSKFLSNYPEYRKTHGNVTKHVALVSEMSRIVEERKIMLISQ
TEQELACTSGQAAAFEAVTSLLNNESVSDIDRLRLVLLYALRYEKESPVQLMQLFNKLAS
RSAKYKSGLVQFLLKQAGVDKRTGDLYGNRDLLNIARNMARGLKGVENVYTQHQPLLFQT
MEGIVKARLRDADYPLVGNHFQQNRPQDVVLFIVGGTTYEEARSVALYNAANPGVRFFLG
GSVVLNSKRFLDDLGEAQRISKSSSLV
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgacgctgatcaccctcatccgcgactacatcgatcgcatgctccacgacatccccggg
atgaaggtcctcgtcctcgaccccgataccgtggggatggtaagcgtggtgtacagccag
tcagatctcctccggaaggaggtgttcctcgtggagacggtcgacaacgcctccagctcc
agggagtccatggcgcacctcaaggccgtctacttcctccgcccctcctccgataacgtc
cagaagctccgccggcatctcgccgccccgcgtttcgccgagtaccacctcttcttctcc
aatgtattgaagattccacagattcaggtgctcgcagattccgatgagcaggaggttgtg
cagcaagttcaggagttctatgctgatttttgtgccatcgacccttaccatttcacgctg
aacatacgcaataaccacgtctacatgcttccaatggtggtggatcctcctggtatgcag
agtttctgtgatcgggctgttgatggcattgcttctgtcttcctggctctcaagcgccgt
cctgttattagataccaaaggacatctgatgttgcaaaaaggattgcacaagaaactgcg
agattgatgtatgagcaggaaagtggcttgtttgattttagacgaactgagaactcttcc
ttgttgctggtgattgacagaagggatgatcctgttaccccgttacttaaccaatggaca
tatcaggcaatggttcatgaacttattggaattgagaacaataaagttgatctaagggaa
tatcctaatgtccctaaagaccagaaggaggtggttctatcatcagttcaggatgaattt
tttagggctaacatgttcgagaattttggtgatcttggtatgaatatcaaaagaatggta
gatgactttcaacatctttcgaagaccagccagaatattcagagcataagtgatatgtca
aaatttctgagcaactaccctgaatatcggaagactcatggaaatgtaacgaagcatgtt
gctttggtcagtgagatgagcagaattgtggaggaaaggaagattatgctaatttcccag
acggagcaagagttagcatgtacaagtggacaagcagctgctttcgaggctgtcacttcc
ttgctaaacaatgaaagtgtgtctgatattgatcgtttacggttagtattgctctatgct
ttgaggtatgaaaaggagagtccggttcagttgatgcagcttttcaataaattggcttct
cgttctgctaaatacaagtcagggctggttcaattcctcctcaaacaggctggtgttgat
aagagaacaggtgacttatatgggaaccgtgatctattaaatattgctcgcaacatggct
cgtggactcaagggcgttgagaatgtatacacccaacatcagcctcttctctttcagacc
atggaaggaattgtaaaggcacgattacgagatgctgattatccgcttgttggcaatcat
ttccagcagaacaggcctcaagatgttgtgctgttcattgttggagggacgacttacgag
gaagcaagatcagtagccctttacaatgcagcaaatcctggagttcggttctttcttggt
ggttcagtggttctaaattcaaagagatttcttgatgacttaggagaggcacagagaata
tcgaaatcgagcagtctagtatga

DBGET integrated database retrieval system