KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329300
Entry
4329300           CDS       T01015                                 
Name
(RefSeq) U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
  KO
K12846  U4/U6.U5 tri-snRNP-associated protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329300
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    4329300
SSDB
Motif
Pfam: SNRNP27
Other DBs
NCBI-GeneID: 4329300
NCBI-ProteinID: XP_015627666
UniProt: Q0E1C9 A0A8J8Y1I7
LinkDB
Position
2:complement(15468005..15477399)
AA seq 199 aa
MSDRRHDREKPRDRDRERGRDGERDRELDRPRDRDHRDRDRDKERDRDRDRDRERRRGER
DRKRSRSPSADRSHRRHSHSHSHRGRSSPSPDAGRHKRRRDGSPAAAATDHKDDKKPEAP
VVPKSAAGDGVAPGDGDVDVEELEMMKMMGIPVGFDSTKGKHVPDADVSGVRVVTKRQPR
QYMNRRGGFNRPLPPERNR
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtccgaccgccgccacgaccgggagaagccccgcgaccgcgaccgggaacgcggccga
gacggcgagcgcgaccgcgagctcgaccgcccccgcgaccgcgaccaccgtgaccgcgac
cgggacaaggagagggatcgagatcgcgaccgcgaccgcgaacgccgccgtggggagcgt
gaccggaagcgctcccgctctccctccgccgaccgctcccaccgccgccactcccactcc
cactcccaccgcggccgctcgtccccgtccccggacgccggccgccacaagcgccgccgc
gacgggtcccccgccgccgccgccaccgaccacaaggacgacaagaagccggaggccccc
gtggtgcccaagagcgccgccggggacggggtcgcgccgggcgacggggatgtggacgtg
gaggagctggagatgatgaagatgatggggatccccgtcggcttcgactccaccaagggg
aagcacgtccccgacgccgacgtcagcggggtgcgcgtcgtcaccaagcggcagccgcgg
cagtacatgaaccgccgtggcgggttcaaccggccccttccaccggagcgcaaccgctga

DBGET integrated database retrieval system