KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329321
Entry
4329321           CDS       T01015                                 
Name
(RefSeq) putative glutathione-specific gamma-glutamylcyclotransferase 2
  KO
K22596  gamma-glutamylcyclotransferase, plant [EC:4.3.2.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4329321
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     4329321
SSDB
Motif
Pfam: ChaC
Other DBs
NCBI-GeneID: 4329321
NCBI-ProteinID: XP_015625958
UniProt: Q6K7C2 A0A0N7KF94
LinkDB
Position
2:complement(15676331..15679684)
AA seq 216 aa
MVLWVFGYGSLIWNPGFDFDEKILGFVKGYKRTFNLACIDHRGTPEHPARTCTLESDEEA
ICWGIAYCVKGGLKKEQEAMKYLERRECEYDQKISVDFYKEGDSLKPAVTGVLVFVSTPD
PVGNKYYLGPAPLEDMARQIATANGPNGNNRDYLFSMEKALSNICHEDDSIIELANEVRK
VLSRPKEKITGSDSPQKSHALVHLSALPEGTVVDSR
NT seq 651 nt   +upstreamnt  +downstreamnt
atggtgctctgggtcttcggctatggctccctgatctggaaccccggattcgacttcgat
gagaagatcctgggcttcgtcaagggctacaaacgcaccttcaatcttgcttgcattgac
catcggggcacgccggagcatcctgcgaggacctgcacacttgagtccgacgaggaagcc
atatgctgggggattgcatactgtgtcaaaggggggcttaaaaaggagcaagaagcaatg
aagtacttggaaagaagagagtgtgagtatgaccagaagatctctgtggatttctacaag
gaaggagattctttgaagccagctgtgacaggtgtactagtctttgtatccactcctgat
ccagtaggcaacaaatactatcttgggcctgctcctttggaggacatggcaaggcaaatt
gctacagccaatggccccaatgggaataacagggattacctgttctcaatggagaaggca
ttgtccaacatatgccatgaagatgattcaatcatcgagctagctaacgaggtcaggaag
gtgttgagccggccgaaggagaagatcactggctccgatagcccacaaaaatctcacgct
ctcgtacacctgtctgcgcttcctgagggcactgttgtggactcaagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335982
Entry
4335982           CDS       T01015                                 
Name
(RefSeq) putative glutathione-specific gamma-glutamylcyclotransferase 2
  KO
K22596  gamma-glutamylcyclotransferase, plant [EC:4.3.2.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4335982
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     4335982
SSDB
Motif
Pfam: ChaC
Other DBs
NCBI-GeneID: 4335982
NCBI-ProteinID: XP_015635685
UniProt: Q7XV22 B9FFF0
LinkDB
Position
4:complement(22355334..22357994)
AA seq 187 aa
MAMWVFGYGSLVWNPGFAHDARLVGFVRDYRRVFYQGSTDHRGTPEFPGRTVTLEHQPGA
TCWGVAYKISTEQDKQTALEHLEVREKQYDEKIYLDLYMDSSPKTPAVKNVMVYLATTNK
QSNQNYLGPAPLEEMAKQIYLAEGPSGPNKEYLFKLEDALNKIGVVDPHVQDLANAVRKY
PDTAVSC
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcgatgtgggtgttcgggtacgggtccctggtctggaaccccggcttcgcgcacgac
gcccgcctcgtcggcttcgtcagggactaccgccgcgtcttctaccaggggagcacggac
cacaggggcacgccggagttccccgggaggaccgtcacgctcgagcaccagcccggcgcc
acatgctggggtgttgcttacaaaatttcaacggaacaagataagcagacagctctggag
catctggaagtaagagagaagcaatatgatgagaagatttaccttgatttgtatatggac
tcctcaccaaaaacaccagccgtcaaaaatgtgatggtatacttagccacaacaaacaag
cagagcaaccaaaactaccttggtcctgcaccgctggaagaaatggccaagcaaatttac
ctagctgaaggcccatctggacctaacaaagagtacctgttcaaacttgaggatgcattg
aacaaaataggagttgttgatccacatgtccaggatctggcaaatgctgtgcgcaagtat
ccagacactgcggtatcttgctga

DBGET integrated database retrieval system