KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329322
Entry
4329322           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 4
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4329322
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4329322
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     4329322
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4329322
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 4329322
NCBI-ProteinID: XP_015624423
LinkDB
Position
2:15697568..15699338
AA seq 432 aa
MREKEKGEAMRRKAEEIADAMAAAWEGPGGSSAARLEQFLRCVHITAVTAGHYQQVQHTS
HHIYIPRIASIPSIRAAMAPELSSPSSSPRYTVGYALLPEKVSSVVRPSLVALAADRGVR
LVAVDVSRPLAEQGPFDLLVHKMYDRGWRAQLEELAARHPGVTVVVDSPGAIDRLLDRAT
MLDVVSGLRTPVSVPPQVVVSDAAADADELLARAALRFPLIAKPLAVDGSAESHDMRLVY
RRDGVLPLLRAPLVLQEFVNHGGVLFKVYVVGDRATCVRRSSLPDVPARRLLDLDAEPSV
PFANISNQPLPPPDDDGGAADDDTPAAGFVDEVARGLRRGLGLHLFNFDMIRERSEEHGD
RYFIIDINYFPGYAKMPGYEAALTDFFLEMLRGTRPVPEQLGPGSGLDMEARKLEPGLGI
GLRELESGRAQA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgcgggagaaggagaagggcgaggcgatgaggaggaaggcggaggagatcgcagacgca
atggcagcggcgtgggaggggccgggcgggtcgtcggcggcgagattggaacagtttctc
agatgcgtgcacatcacagccgttacagctggtcactaccaacaagtacaacacacaagt
catcacatatatatacctcgcatcgcatcgattccatcgattcgcgcggccatggcgccc
gagctgtcctccccgtcgtcgtcacctcgctacaccgttggctacgcgctgctgccggag
aaggtgagcagcgtcgtgcggccgtcgctggtggcgctggccgccgaccgcggggtgcgc
ctcgtcgccgtcgacgtgtcgcggccgctcgccgagcagggcccgttcgacctcctcgtg
cacaagatgtacgaccgcgggtggcgcgcccagctggaggagctcgccgcgcgccacccc
ggggtgaccgtcgtcgtcgactcccccggcgccatcgaccgcctcctcgaccgcgccacc
atgctcgacgtcgtctccggcctccgcacccccgtctccgtcccgccccaggtcgtcgtc
agcgacgccgccgccgacgcggacgagctcctcgcccgcgccgcgctccgcttcccgctc
atcgccaagccgctcgccgtcgacggcagcgccgagtcgcacgacatgcgcctcgtctac
cgccgcgacggcgtcctccccctcctccgcgcgccgctcgtcctccaggagttcgtcaac
cacggcggggtgctcttcaaggtctacgtcgtcggcgaccgcgccacctgcgtgcgccgg
agcagcctccccgacgtgccggcccgccgcctcctcgacctggacgccgagccctccgtc
cccttcgccaacatctccaaccagccgctccccccacctgatgacgacggcggcgccgcc
gacgacgacacgccggccgccggcttcgtggacgaggtggcgcgcgggctccggcgaggg
ctgggcctgcacctgttcaacttcgacatgatccgggagaggagcgaggagcacggcgac
aggtacttcatcatcgacatcaactacttcccgggctacgccaagatgccgggctacgag
gcggccctcacggatttcttccttgagatgctccgtggcacaagacctgttcctgagcag
ctgggcccgggctcgggcctggacatggaggcccgcaagctcgagcctgggctgggtatc
ggtctaagagaattggagtctggccgagctcaggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332146
Entry
4332146           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 2 isoform X1
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4332146
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4332146
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     4332146
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4332146
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 4332146
NCBI-ProteinID: XP_015632763
UniProt: Q10PL5
LinkDB
Position
3:6901929..6907420
AA seq 349 aa
MRLHGEVSFDEDEEEVVMVPAAALSSSPLNGGAVPVTRLVVGYALTKKKVKSFLQPNLLL
LARKKGINLVAIDDTRPLAEQGPFDVILHKITSKEWQQVLEDYHEEHPEVTVLDPPNAIN
HLNNRQSMLAEVSDLNLSSFYGEVCTPRQLVIMRDPSSIPTAVAMAGLTLPLVAKPLVVD
GTSKSHELSLAYDEASLSMLDPPLVLQEFVNHGGILFKVYIIGETIQVVRRFSLPDVNTY
DLLNNVGVYRFPRVSCAAASADHADLDPHISELPPRPLLEKLGKELRGRLGLRLFNIDMI
RELGTKDRYYIIDINYFPGFGKMPGYEHIFTDFLLNLAQSKYKKCLSGG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcggctgcacggggaggtttccttcgatgaggacgaggaggaagtggtgatggttccg
gcggcggcgctgtcgtcgtcgccgctcaacggcggggccgttccggtgacgaggctcgtg
gtggggtacgccctcaccaagaagaaggtgaagagcttccttcagcccaatctgctgttg
ctggcgaggaagaagggaattaatcttgtagcaattgatgacactcgcccgcttgcagaa
caaggcccatttgatgttatcttgcacaagattactagcaaggaatggcaacaggttctg
gaggattatcatgaggaacatccagaggttactgtccttgacccaccaaatgccatcaat
catctgaataatcggcaatctatgcttgcagaagtatctgatttgaacttatccagtttc
tatggagaagtttgcactccacgccaactggtcattatgagagatccatcctctatacca
accgcagttgccatggctggactaaccttgcccttggttgcgaagccattggttgttgat
ggaacatctaaatcccacgaactatctcttgcatatgatgaggcatccttatcaatgctt
gatcctcctctggtcctccaggaatttgtgaaccatggtgggatcctctttaaggtgtac
atcattggtgaaactatacaagttgtacggaggttttctcttcctgatgttaacacttat
gacttattaaacaatgttggcgtctatcgatttccaagagtttcatgtgctgcagctagt
gcagaccatgcagacctcgatcctcatatctcagaacttcctccaagaccactcctagag
aaactgggaaaagagcttcgtggaagactgggtttaagattgttcaacatagatatgatc
agagaacttggaaccaaagatcggtactatataattgacatcaactacttcccagggttc
gggaaaatgccaggttatgagcacatattcaccgatttcttgctgaatcttgcgcaaagc
aagtacaagaagtgcttaagcggcggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333967
Entry
4333967           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 3
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4333967
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4333967
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     4333967
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4333967
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 4333967
NCBI-ProteinID: XP_015630337
UniProt: Q75GI4
LinkDB
Position
3:29535966..29542815
AA seq 357 aa
MVSGGRVGGGEGEAGEAAEVAVAMVDNEEEMAQAQAPPAAAVAARELVVGYALTSKKAKS
FLQPKLRGLARKKGILFVAIDQKRPLSDQGPFDIVLHKLTGREWQQLLEEYREEHPEVTV
LDPPGAIEHLLNRQSMLQEVSELDLSDCHGRVGVPKQLFVNTDPSSIPAAVMRAGLSLPL
VAKPLVAKSHELSLAYDPISLTKLEPPLVLQEFVNHGGVLFKVYIVGDAIRVVRRFSLPN
VDVGDLSNNAGVFRFPRVSCASANADDADLDPHVAELPPRPLLEILARELRRRLGLRLFN
IDMIREHGTRDRFYVIDMNYFPGYGKMPGYEHVFTDFLLSLVQKEYKRRPSYSSCEG
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggtgtcgggtgggcgcgtggggggtggagaaggggaggcgggggaggcggcggaggtg
gcggtggcgatggtggataatgaggaggagatggcgcaggcgcaggcgccacccgcggcg
gcggtggcggcgagggagctggtggtggggtacgcgctgacgtcgaagaaggccaagagc
ttcctccagcccaagctccgcggactcgccaggaagaaagggatcctttttgttgctatt
gatcaaaaacgtccactgtcagatcaaggaccttttgacattgttctgcataagttgaca
ggaagggagtggcaacaattattggaggaatatagggaggaacacccagaagttactgtt
cttgacccaccaggtgccatagaacatctgcttaatcgtcaatctatgcttcaagaggtt
tctgaattggacctctcagattgtcatggtagagtcggtgttcctaagcagctgtttgtt
aatacagatccatcatcaataccagctgctgttatgagggctggtctatctcttccatta
gtggcaaagcctctggtggcaaaatcccatgagttatctcttgcttatgatccaatctcc
ttgacgaagcttgagcctccgcttgttcttcaggaatttgtaaaccatggtggtgtcttg
tttaaggtctacattgttggggatgcgatacgggttgtgcgtaggttttcgcttcccaac
gttgatgtaggtgatttatcaaacaatgctggagtatttcggtttccaagggtctcttgt
gcttcagccaacgcagatgatgcagatctggacccccatgttgctgaacttcctccaaga
ccacttctcgagatattggcaagagagctgcgccgacgattgggtcttagattgtttaac
attgatatgattagagagcatgggacaagagatcggttctatgtcatagacatgaactat
tttcctgggtatggtaaaatgcctggatatgaacatgtattcaccgactttctgctgagt
ctagttcaaaaggagtacaaacgacgaccaagctatagctcatgcgaggggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347597
Entry
4347597           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 6
  KO
K01765  inositol-1,3,4-trisphosphate 5/6-kinase [EC:2.7.1.159]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4347597
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4347597
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N FCH
Other DBs
NCBI-GeneID: 4347597
NCBI-ProteinID: XP_015611234
LinkDB
Position
9:complement(20241236..20248523)
AA seq 911 aa
MRVTTDTWPRRAAQEPLLLLLLRSSLMKSASLQALNPNRAMAAMGRSVRVVLDSSVLLDP
SGVTAEEEEVVVALRPGAEALLRRLRYSNLRVAICHPEGLPTNESGFLEKTAKLYSFGYM
PLTSPSGSNLLNELMLEWSGTNFCFYVTSGVHEGLLSELQNHNWEVIAMGNEDVIKNSGV
IHISMLQELLITLATSIKKEIGNSSAFVVGYVMKQSREEDFAKRGAFPIYPSKNDLIFVP
LSFELPLASQLQEVDLVLHKITDEIINIDPNSSISFPKGISFSPGMSEIIRFVEEHCDFC
VIDPFKNIYPLLDRIQIQEILIRLEGLSAEGRPKLRAPCFLKIESFCGSELQKQLAEAKL
SFPLIVKPQVACGVADAHNMALIFKIEEFSNLSVPLPAILQEYIDHGSKIFKFYAIGDKI
FHAIKNSMPNASHLKSSSGGKPLTFNSLKTLPVATKEQLLQNEVQDSKLLDINLVEEAAK
LLKELLGLTIFGFDVVVQESSGDHVIVDLNYLPSFKEVPDNVAMPAFWDAIKQSYESRKQ
MTQTYIQMKPLSSFSTHPMLQGWFQDCQHIFVLGVFSMDRLKRVTGMAKGLSAVPAQKNE
DESLVLFGELYRHEKEKDVNLLEPMYSVEFEAIQGTSRMFKLPSGKKDYLLPDGGKHDYD
WLKTPPATPLFPSLEMEANSSQMVFQRELPILQPVKTSRFSIKPEPTSTSTRTESPTSSS
SKSATPTARSSSSSSKKNFTKGDPALSEVTTAYKMDKRSSYTPLKNIQQLAAPTTKSTAA
SKAAKKTSASKKPEFPGSTNAVNKMAKLGIPDKPLKKTTATAPKARSKDPAIGMKDLKMD
AGTARRMPCPPAATVGSNNELNKVAGKGRRRTGGEPAPGNGSRATEATTNGRRRAVAEKE
HGQRLGSLAKK
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgcgagtcaccactgacacctggccccgccgcgccgcccaagaacctctccttcttctc
ctcctccggtcctccctgatgaaaagcgcgtcactgcaagcactgaacccaaaccgagcc
atggcggccatggggcgatctgtgcgggtggtgctggactcctccgtcctcctcgaccca
tccggtgttacagcggaggaggaggaggtggtggtggcgctgcggcctggggcggaggcg
ctgctgcggcgcctgcgatactccaatctccgggtggcaatttgccatccggagggcttg
ccaactaatgagtcaggttttcttgagaagactgcaaaattgtactcctttggatatatg
ccacttacatctccaagtgggagcaatttactaaatgagttgatgttagaatggagtgga
acgaatttttgcttctatgtgacttcaggagttcatgaaggtctactatctgaacttcag
aatcacaactgggaagttattgccatgggtaatgaagatgtcataaagaactctggagtt
atacatattagcatgcttcaagagttacttatcactttggcaacttcaataaaaaaggaa
ataggaaactcatctgctttcgtggttggctatgttatgaaacaatcccgtgaggaagac
tttgccaagagaggagcattccccatttatcctagtaaaaacgatcttatctttgttcca
ctctcttttgaacttcccttagcttctcaattgcaagaagttgatctagtgctacacaaa
ataactgatgagatcatcaacattgatccaaactcttccatcagttttccgaaggggatt
tcattttctccgggaatgtctgaaattataaggtttgtagaagagcactgtgatttttgt
gtaattgatccattcaaaaatatttatccattgctggatcgcatccaaattcaagaaatt
ctaatccgactggaaggacttagcgccgaaggaaggccaaaactccgagcaccatgcttt
ttaaagattgaaagcttttgtggcagtgaattacagaaacaactagcagaagctaagtta
tcctttccgctcattgtgaagccacaagtagcatgtggagttgctgatgcccacaatatg
gcattgattttcaaaatcgaagaatttagcaaccttagtgtgcctcttccagctattcta
caggaatatattgaccatggatccaaaatattcaaattttatgcaattggagacaagatt
tttcatgctattaagaactcaatgcccaatgcaagtcatcttaaatcatcatcaggaggc
aaacctcttacattcaacagtttgaagactcttccagtggctacaaaggagcagctgctg
caaaacgaggtgcaagatagcaaattgttggacattaatctagtagaagaggctgcaaaa
ttgctgaaggaattgctagggcttacaatatttgggtttgatgtcgttgttcaagagtcc
agtggagaccatgtcatagtggacctaaactatcttccgtctttcaaagaagttcctgac
aatgtggcgatgcctgcattctgggatgcaatcaagcagtcatatgagtcaaggaagcag
atgacacaaacttacatacagatgaagcccttgagctccttttcaactcatcccatgctc
cagggatggtttcaggattgccagcacatttttgtccttggagtattcagtatggatcgc
ctgaagagagttactggcatggctaagggattatcagctgttccggctcagaaaaacgaa
gacgagagcttggttctctttggtgagctgtacaggcatgagaaggagaaggatgtgaac
ctccttgaaccaatgtactcagtggagttcgaagcaattcaaggaaccagtcgtatgttc
aagttaccatcaggcaagaaagattacctcctaccagatggtggaaagcacgattacgac
tggctcaagactcctccagctactccactgttcccttccctcgagatggaagctaattcc
tctcaaatggtttttcagagagaattgcctatccttcagccagttaaaacttcaaggttc
tcaatcaagcctgaaccaacaagcacatcaacaagaactgaatcgcctacctccagctcc
tcaaagtctgctactccgacggcaagatccagtagctcttcatcaaagaaaaacttcacc
aaaggagatcctgctctctctgaagtgaccacagcttacaaaatggacaagagatcaagc
tacactcctctgaagaacatacaacaacttgcagctccaacaactaaaagtacagcagcc
agcaaagcagccaagaaaacctcagccagcaagaagcctgaattcccaggcagcacaaat
gcagtaaacaaaatggccaaactaggaatccccgacaagccgctgaagaaaaccacagcg
actgcaccgaaagctcggtccaaagatcccgcaattggtatgaaggatctgaaaatggat
gctggcacagcaagaagaatgccatgcccacctgctgcaacagtgggtagcaacaatgag
cttaacaaagttgcagggaaaggaaggagaagaactggaggtgagcctgctcctggcaat
ggcagccgtgccactgaagctactacaaatggaaggagaagagcagttgctgagaaggag
catggacaaaggcttggaagccttgcaaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347947
Entry
4347947           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 1
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4347947
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4347947
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     4347947
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4347947
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 4347947
NCBI-ProteinID: XP_015615026
UniProt: Q33BI9
LinkDB
Position
10:complement(301785..308108)
AA seq 354 aa
MRVHEEASEDKEREVEEAPDLMPLSPPLTAAATAAVVAVAGQRLVVGYALTKKKVKSFLQ
PKLLSLARKKSIHFVSIDETRPLSEQGPFDIILHKLTDKEWQQVLEDYREEHPEVTVLDP
PNAIQHLHNRQSMLQEVADLNLSNAYGEVCTPRQLVIMKDPLSIPSAVAKAGLTLPLVAK
PLVVDGTSKSHELSLAYVETSLSMLDPPLVLQEFVNHGGILFKVYVVGETIRVVRRFSLP
DVNIYDLENNDGIFRFPRVSCATNTAEDAEVDPSIAELPPKPLLEKLGRELRRRLGLRLF
NFDMIREHGRKDRYYVIDINYFPGYGKMPGYEHIFIDFLLSLVQNKYKRRLSGS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggtgcacgaggaggcgtcggaagacaaggagcgggaggtggaggaggcgccggac
ctgatgccgctgtctccgccgctgaccgccgccgccactgccgccgtggttgcggtggcg
gggcagcggctggtggtgggctacgccctgaccaagaagaaggtgaagagcttcctccag
cccaagctgctctcgctcgccaggaagaagagcattcattttgtatcaattgatgagact
cgtcctctctctgaacaaggcccgtttgatattatattgcacaagcttactgacaaggag
tggcagcaagttttggaggattatcgtgaagaacatccagaagtaactgtccttgatcca
cctaatgctattcaacatttgcacaatcgccagtcaatgcttcaagaagttgctgatttg
aacttatcaaatgcctatggtgaggtttgcactccacgacagctggttatcatgaaagac
ccattgtctataccatctgcagttgccaaggctggactaacgttgcccttggttgccaaa
ccattggtagttgatggaacatcgaaatcccatgaactatctcttgcatatgtggagaca
tccttgtcaatgcttgatcctcctctggttctccaggaatttgtcaatcatggtgggatc
ttatttaaggtatatgttgttggtgaaacaatacgtgttgttcgccgattttctcttcct
gatgtaaacatctatgatctggaaaacaatgatggcatcttccgttttccgagagtttcc
tgtgctacaaatactgcagaagatgcagaagttgacccttctattgctgaacttcctcca
aagccgcttctagagaaacttgggagggagcttcggcgcagactgggtcttagactgttt
aacttcgatatgattagagagcatggaagaaaggatcggtactatgtcattgacatcaac
tattttcctggatatgggaaaatgccaggctatgagcatatattcattgacttcctactc
agccttgtgcaaaacaagtacaagaggcgtttaagcgggagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349492
Entry
4349492           CDS       T01015                                 
Name
(RefSeq) inositol-tetrakisphosphate 1-kinase 5
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Module
osa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4349492
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4349492
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     4349492
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     4349492
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 4349492
NCBI-ProteinID: XP_015614076
UniProt: Q7XBW0
LinkDB
Position
10:complement(22943505..22945220)
AA seq 342 aa
MAGDEPLPGDGQRRRYLIGYALAPKKQQSFIQPSLVSRAAGRGMDLVPVDPSRPLPEQGP
FHLLIHKLYGEEWRGQLDAFSAAHPAVPVVDPPHAIDRLHNRISMLQVVSELDVPLHAHH
HHTFGIPSQVVVYDAAALSDSGLLAALRFPLIAKPLVADGTAKSHKMSLVYHREGLRKLR
PPLVLQEFVNHGGVIFKVYVVGAHVTCVKRRSLPDVSSDVLQDASAEGSLSFSQVSNLPN
ERTAQEYYDDMRLEDAIMPPTAFINDIAAALRRALGLHLFNFDMIRDARAGDRYLVIDIN
YFPGYAKMPGYETVLTDFFWEMVHKDDDTPNLNPNPNDEDVK
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggccggcgacgagcccctccccggcgacgggcagcggcggcgctacctcatcggctac
gccctggcgccgaagaagcagcagagcttcatccagccgtcgctggtgtcgcgcgcggcg
gggcgcggcatggacctcgtccccgtcgacccctcgcggcccctccccgagcaggggccc
ttccacctcctcatccacaagctctacggcgaggagtggcgcggtcagctggacgccttc
tccgccgcgcacccagccgtccccgtcgtcgacccgccccacgccatcgaccgcctccac
aaccgcatctccatgctccaggtcgtctccgagctcgacgtcccgctccacgcccaccac
caccacaccttcggcatcccctcccaggtcgtcgtctacgacgccgccgccctctccgac
tccggcctcctcgccgccctccgcttccccctcatcgccaagcccctcgtcgccgacggc
accgccaagtcccacaagatgtccctcgtctaccaccgcgagggcctccgcaagctccgc
cccccgctcgtcctccaggagttcgtcaaccacggcggcgtcatcttcaaggtctacgtc
gtcggcgcccacgtcacctgcgtcaagcgccgcagcctccccgacgtctccagcgacgtc
ctccaggacgcctccgccgagggctccctctccttctcccaggtctccaacctccccaac
gagcgcaccgcccaggagtactacgacgacatgcgcctcgaggacgccatcatgccaccc
accgccttcatcaacgacatcgccgccgccctccgccgcgccctcggcctccacctcttc
aacttcgacatgatccgggacgcccgcgctggggatcgctacctcgtcattgacatcaac
tacttccccggctatgccaagatgcccggatacgagactgtgctcaccgatttcttctgg
gagatggttcacaaggacgacgacacgcccaacctcaaccccaaccccaatgacgaggat
gtcaaatga

DBGET integrated database retrieval system