KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329324
Entry
4329324           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 CYP73A100
  KO
K00487  trans-cinnamate 4-monooxygenase [EC:1.14.14.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329324
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4329324
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4329324
   00941 Flavonoid biosynthesis
    4329324
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4329324
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.91  trans-cinnamate 4-monooxygenase
     4329324
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP73 family
   4329324
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4329324
NCBI-ProteinID: XP_015623447
UniProt: Q0E1B0
LinkDB
Position
2:complement(15716850..15718852)
AA seq 533 aa
MAASVVRVAIATGASLAVHLFVKSFLQAQHPALTLLLPVAVFAGIAVGAKGGNGGDGKAP
PGPAAVPVFGNWLHVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ
GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM
DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS
RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRRKVMDTPGDRNKL
RCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKVRAE
INDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPKGSK
VVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCPGIIL
ALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcagcctccgtggtgagggtggccatcgccaccggggcgtcgttggcggtgcatttg
ttcgtcaagtcgttcttgcaggcgcagcatcctgctctcaccttgctgctgccggtggct
gtgtttgccggcattgcggtgggcgcgaagggcgggaacgggggcgacgggaaggcgccg
ccggggccggcggccgtgccggtgttcggcaactggctgcacgtcgggaacgacctgaac
cacaggttcctcgcggcgatgtcggcgcggtacgggcccgtgttccgtctgcggctgggc
gtgcgcaacctggtggtggtgtcggacccgaagctggcgacggaggtgctgcacacgcag
ggcgtggagttcggctcccgcccgcgcaacgtcgtcttcgacatcttcaccgccaacggc
gccgacatggtgttcaccgagtacggcgaccactggcgacgcatgcgccgcgtcatgacg
ctgccgttcttcacggcgcgcgtcgtgcagcagtacaaggccatgtgggaggccgagatg
gacgccgtcgtggacgacgtgcgcggcgacgcggtggcgcagggcaccggcttcgtggtg
cgacgcaggctgcagctcatgctgtacaacatcatgtaccggatgatgttcgacgcgcgg
ttcgagtcggtggacgaccccatgttcatcgaggccaccaggttcaactccgagcgcagc
cgcctcgcgcagagcttcgagtacaactacggcgacttcatccccatcctccgtcccttc
ttgcggggctacctcaacaagtgccgtgacctccagagcaggaggctcgccttcttcaac
aacaactacgtcgagaagagaaggaaggtgatggacactccgggagacaggaacaagctc
cggtgcgcgatcgaccatatccttgaggcggagaagaacggcgagctgacggcggagaac
gtgatctacatcgtggagaacatcaacgtggccgccatcgagacgacgctctggtccatc
gagtgggcgctggccgaggtcgtcaaccacccggcggtgcagagcaaggtccgcgccgag
atcaacgacgtgctcggcgacgacgagcccatcaccgagtccagcatccacaagctgact
tacctgcaggccgtgatcaaggagacgctgcggctgcactccccgatcccgctgctggtg
ccgcacatgaacctggaggaggccaagctcggcgggtacaccatccccaagggatccaag
gtggtggtgaacgcgtggtggctggccaacaacccggcgctgtgggagaaccccgaggag
ttccggcctgagcggttcttggagaaggagagcggcgtggacgccaccgtcgccgggaag
gtggacttcaggttcctgcccttcggcgtgggccgccgcagctgcccggggatcatcctg
gcgctgcccatcctggcgctcatcgtcgggaagctggtgaggagcttcgagatggtgccg
ccgccgggcgtggagaagctggacgtgagcgagaaaggcgggcagttcagcctccacatc
gccaagcactccgtcgtcgccttccaccccatctctgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329329
Entry
4329329           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 CYP73A100
  KO
K00487  trans-cinnamate 4-monooxygenase [EC:1.14.14.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329329
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4329329
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4329329
   00941 Flavonoid biosynthesis
    4329329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4329329
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.91  trans-cinnamate 4-monooxygenase
     4329329
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP73 family
   4329329
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4329329
NCBI-ProteinID: XP_015626579
UniProt: A0A0P0VIU1 Q6K7B1
LinkDB
Position
2:15734823..15736891
AA seq 533 aa
MAASAMRVAIATGASLAVHLFVKSFVQAQHPALTLLLPVAVFVGIAVGAKGGSGGDGKAP
PGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ
GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM
DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS
RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRRKVMDTPGDRNKL
RCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKVRAE
INDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPKGSK
VVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCPGIIL
ALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcggcctccgcgatgagggtggccatcgccaccggggcgtcgttggcggtgcatttg
ttcgtcaagtcgttcgtgcaggcgcagcatcctgctctcaccttgctgctgccagtggct
gtgtttgtcggcattgcggtgggcgcgaagggcgggagcggtggtgacgggaaggcgccg
ccggggccggcggccgtgccggtgttcggcaactggctgcaggtgggcaacgacctgaac
caccggttcctcgcggcgatgtcggcacggtacggtcccgtgttccgtctgcggctgggc
gtgcgcaacctggtggtggtgtcggacccgaagctggcgacggaggtgctgcacacgcag
ggcgtggagttcggctcccgcccgcgcaacgtcgtcttcgacatcttcaccgccaacggc
gccgacatggtgttcaccgagtacggcgaccactggcgacgcatgcgccgcgtcatgacg
ctgccgttcttcacggcgcgcgtcgtgcagcagtacaaggccatgtgggaggccgagatg
gacgccgtcgtggacgacgtgcgcggcgacgcggtggcgcagggcaccggcttcgtggtg
cgacgcaggctgcagctcatgctgtacaacatcatgtaccggatgatgttcgacgcgcgg
ttcgagtcggtggacgaccccatgttcatcgaggccaccaggttcaactccgagcgcagc
cgcctcgcgcagagcttcgagtacaactacggcgacttcatccccatcctccgtcccttc
ttgcggggctacctcaacaagtgccgtgacctccagagcaggaggctcgccttcttcaac
aacaactacgtcgagaagagaaggaaggtgatggacactccgggagacaggaacaagctc
cggtgcgcgatcgaccatatccttgaggcggagaagaacggcgagctgacggcggagaac
gtgatctacatcgtggagaacatcaacgtggccgccatcgagacgacgctctggtccatc
gagtgggcgctggccgaggtcgtcaaccacccggcggtgcagagcaaggtccgcgccgag
atcaacgacgtgctcggcgacgacgagcccatcaccgagtccagcatccacaagctgact
tacctgcaggccgtgatcaaggagacgctgcggctgcactccccgatcccgctgctggtg
ccgcacatgaacctggaggaggccaagctcggcgggtacaccatccccaagggatccaag
gtggtggtgaacgcgtggtggctggccaacaacccggcgctgtgggagaaccccgaggag
ttccggcctgagcggttcttggagaaggagagcggcgtggacgccaccgtcgccgggaag
gtggacttcaggttcctgcccttcggcgtgggccgccgcagctgcccggggatcatcctg
gcgctgcccatcctggcgctcatcgtcgggaagctggtgaggagcttcgagatggtgccg
ccgccgggcgtggagaagctggacgtgagcgagaaaggcgggcagttcagcctccacatc
gccaagcactccgtcgtcgccttccaccccatctctgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338409
Entry
4338409           CDS       T01015                                 
Name
(RefSeq) trans-cinnamate 4-monooxygenase
  KO
K00487  trans-cinnamate 4-monooxygenase [EC:1.14.14.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4338409
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4338409
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4338409
   00941 Flavonoid biosynthesis
    4338409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4338409
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.91  trans-cinnamate 4-monooxygenase
     4338409
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP73 family
   4338409
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4338409
NCBI-ProteinID: XP_015639656
UniProt: Q5W6F1
LinkDB
Position
5:complement(14900001..14904556)
AA seq 500 aa
MDALLVEKVLLGLFVAAVLALVVAKLTGKRLRLPPGPAGAPIVGNWLQVGDDLNHRNLMA
LARRFGDILLLRMGVRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTNKVVAQNRAGWEEEARLVVEDVRRDPAAATSGVVIRRRLQL
MMYNDMFRIMFDRRFDSVDDPLFNKLKAFNAERSRLSQSFEYNYGDFIPVLRPFLRRYLA
RCHQLKSQRMKLFEDHFVQERKRVMEQTGEIRCAMDHILEAERKGEINHDNVLYIVENIN
VAAIETTLWSIEWGIAELVNHPSIQSKVREEMASVLGGAAVTEPDLERLPYLQAVVKETL
RLRMAIPLLVPHMNLADGKLAGYDIPAESKILVNAWFLANDPKRWVRPDEFRPERFLEEE
KAVEAHGNDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQSFDLLPPPGMDKVDTTEKP
GQFSNQILKHATVVCKPIDA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggacgccctcctcgtggagaaggtcctcctgggcctgttcgtggcggcggtgctggcc
ctagtggtggccaagctcaccgggaagaggctccgcctcccgcccggccccgccggcgcg
cccatcgtcggcaactggctccaggtcggcgacgacctcaaccaccgcaacctgatggcg
ctggcgcggcggttcggcgacatcctcctcctccgcatgggcgtccgcaacctggtggtg
gtgtccagcccggacctcgccaaggaggtgctccacacccagggcgtcgagttcggctcc
cgcacccgcaacgtggtgttcgacatcttcaccgggaaggggcaggacatggtgttcacc
gtgtacggcgaccactggcgcaagatgcggcggatcatgacggtgcccttcttcaccaac
aaggtggtggcccagaaccgcgcgggttgggaggaggaggcgaggctggtggtggaggac
gtccgccgcgaccccgccgcggcgacctccggcgtggtgatccggcgaaggttgcagctg
atgatgtacaacgacatgttccgcatcatgttcgaccgccgtttcgacagcgtggacgac
ccgctcttcaacaagctcaaggccttcaacgcggagcgcagccgcctctcgcagagcttc
gagtacaactacggtgacttcatccccgtcctccgccccttcctccgccgctacctcgca
cgctgccaccagctcaagtcccagcgcatgaagctcttcgaggaccacttcgtccaggaa
cgcaagagagtgatggaacagactggtgagatccggtgcgccatggaccacatcctcgag
gccgagaggaagggcgagatcaaccacgacaacgtcctctacatcgtcgagaacatcaac
gttgctgctatcgagacgacgctgtggtcgatcgaatggggaatcgcggagctggtgaac
cacccgagcatccagtcgaaggtgcgggaggagatggcgtcggtgctgggcggcgcggcg
gtgacggagccggacctggagcggctgccgtacctgcaggcggtggtgaaggagacgctg
cggttgcgcatggcgatcccgctgctggtgccgcacatgaacctcgccgacggcaagctc
gccggctacgacatccccgccgagtccaagatcctggtgaacgcgtggttcctcgccaac
gaccccaagcggtgggtgcgccccgacgagtttaggccggagaggttcctggaggaggag
aaggccgtggaggcgcacggcaacgacttccgcttcgtgcccttcggcgtcggccgccgc
agctgccccgggatcatcctcgcgctgcccatcatcgggatcacgctcggccgcctcgtc
cagagcttcgacctgctgccgccgcccgggatggacaaggtggacaccaccgagaagccc
ggccagttcagcaaccagatcctcaagcacgccaccgtcgtctgcaagcccatcgacgcc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270590
Entry
9270590           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: trans-cinnamate 4-monooxygenase
  KO
K00487  trans-cinnamate 4-monooxygenase [EC:1.14.14.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    9270590
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9270590
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    9270590
   00941 Flavonoid biosynthesis
    9270590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9270590
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.91  trans-cinnamate 4-monooxygenase
     9270590
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP73 family
   9270590
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9270590
NCBI-ProteinID: XP_015635394
LinkDB
Position
1:complement(34961823..34963767)
AA seq 497 aa
MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAA
LARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPXRRRLQLMMYSNVYR
IMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLRICEEVKET
RLKLFKDFFLEERKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAI
ETTLWSMEWAIAELVNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLR
MAIPLLVPHMNLRDAELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNV
EANGNDFRYLPSGAGRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQF
SLHILKHSTIVAKPRAF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggacctcctcttcgtggagaggctcctcgtcggcctcctcgcagccgccgtggtcgcg
atcgccgtgtccaagctccgcggccggaagctccgcctgccacccggccccaccccggtg
cccgtcttcggcaactggctgcaggtcggcgacgacctcaaccaccgcaacctggcggcg
ctggcgcggaggttcggcgacatcttcctcctccggatggggcagcgcaacctggtggtg
gtctcctcgccgccgctggcgcgggaggtgctccacacgcagggggtggagttcgggtcg
cgcacccgcaacgtggtgttcgacatcttcaccggcaaggggcaggacatggtgttcacc
gtgtacggcgaccactggcgaaagatgcggcggatcatgacggtgccgttcttcaccggc
aaggtggtgcagcggcaccgcgccgggtgggaggccgaggccgcggccgtggtggacggc
ctccgcgccgaccccngccgccgccgcctgcagctcatgatgtacagcaacgtgtaccgc
atcatgttcgaccgccggttcgagagcgcggacgacccgctgttcctccgcctcaaggcg
ctcaacggcgagcgcagccgcctcgcgcagagcttcgagtacaactacggcgacttcatc
cccatcctccgccccttcctccgcggctacctcaggatctgcgaggaggtcaaggagacc
cgcctcaagctcttcaaggacttcttcctcgaggagaggaagaagctagcgagcaccaag
gccatggacaacaatgggctcaaatgcgccattgatcacatcctggaggcgcagcagaag
ggggagatcaacgaggacaacgtgctctacattgtcgagaacatcaatgttgccgcgatc
gagacgacgctgtggtcgatggagtgggcgatcgcggagctagtgaaccacggggagatc
caggagaagctgcgccgggagctggacacggtgctcggcccggggcgtcagatcacggag
ccggacacgcacaggctcccctacctgcaggccgtggtcaaggagacgctccggctgcgc
atggccatcccgctgctggtgccgcacatgaacctccgcgacgccgagctcgccgggtac
ggcatccccgccgagagcaaggtgctcgtcaacgcgtggtacctcgccaacgaccccggg
cggtggcggcggccggaggagttccggccggagaggttcctcgaggaggagaggaacgtc
gaggccaacggcaacgacttcaggtacctgccgtccggcgccgggcggcggagctgcccc
ggcatcgtcctcgcgctgcccatcctcggcgtcaccatcggccgcctcgtccagaacttc
gagctgctgccgccgcccgggaaggacagggtcgacaccaccgagaagggtgggcagttc
agcctccacatcctgaagcactccaccattgtcgccaagccgagagcgttctag

DBGET integrated database retrieval system