KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329330
Entry
4329330           CDS       T01015                                 
Name
(RefSeq) UDP-N-acetylglucosamine transferase subunit ALG13 homolog
  KO
K07432  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4329330
   00513 Various types of N-glycan biosynthesis
    4329330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329330
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     4329330
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4329330
SSDB
Motif
Pfam: Glyco_tran_28_C HIF-1 UDPGT
Other DBs
NCBI-GeneID: 4329330
NCBI-ProteinID: XP_015626580
LinkDB
Position
2:15740104..15742991
AA seq 172 aa
MGDRERRTVFVTVGTTCFDALVKAVDSPQVKEALLEKGYTDLIIQMGRGTYVPSKVSGDG
TLQVDYFTFSPSIADYIRDASLVISHAGSGSIFETLRHGKPLIVVVNEDLMDNHQSELAE
ELATRKHLFCASPQTLGETIQEMDIETLNPYVPGDAKPVVSLINKFFGFPDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggagatagggaaagacgaactgtgtttgtcacagtagggaccacgtgttttgatgct
cttgtcaaggcagtagattccccgcaagtcaaagaagctctactggaaaaaggttatact
gatctaataattcaaatgggccgaggtacatatgttccatctaaggtctcaggagatgga
actcttcaagttgattatttcactttttcgccaagcattgctgattatataagggatgct
tccctggtcatcagtcatgcaggttcaggaagcatattcgagacgttgcgacatggcaaa
cctctaattgttgttgtaaatgaggatttgatggacaatcatcagagtgagttagcagag
gaactggctacaaggaaacacctcttctgtgcaagcccacaaacactaggagagacgatc
caggaaatggacatagagactctcaacccttatgtgccaggggatgccaaaccagttgta
tcgctgattaacaagttttttggcttcccagatgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333143
Entry
4333143           CDS       T01015                                 
Name
(RefSeq) UDP-N-acetylglucosamine transferase subunit ALG14 homolog
  KO
K07441  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4333143
   00513 Various types of N-glycan biosynthesis
    4333143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4333143
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     4333143
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4333143
SSDB
Motif
Pfam: Alg14
Other DBs
NCBI-GeneID: 4333143
NCBI-ProteinID: XP_015632853
UniProt: B9F936 Q84ME6
LinkDB
Position
3:complement(17616248..17622347)
AA seq 229 aa
MGPDVSMAVCCAFPVLVSLLLVRFAYVMYHSGHMPSKLSASAAGMRSLIVLGSGGHTAEM
MNVVTTLQKDRFTPRYYVAALTDNMSLQKAQVYEQSLVRVEVDKEEGVENAQFVQIYRSR
EVGQSYITSIATTLLATSHAIWIIIRIRPQVIFCNGPGTCIPLCVSAFLLKVLGLGWSSI
FYIESIARVKKLSLSGLLLYKLRIADQFFVQWPQLQQKYPRACYAGRLM
NT seq 690 nt   +upstreamnt  +downstreamnt
atggggccggatgtctccatggccgtgtgttgcgcctttccagtacttgtgtctttgctt
cttgtccgcttcgcatatgtgatgtatcacagcggtcacatgccttcgaaactctcagct
tcagctgctggaatgcggtctctcatcgtccttgggtctggaggacatactgcagaaatg
atgaatgttgtaactacacttcagaaggatagatttactccaaggtactatgtagctgca
cttactgacaacatgagccttcagaaggcacaggtctatgagcagtcattggttcgggtt
gaggttgataaagaagagggtgttgagaatgcacagttcgtacagatatatcgcagtcgt
gaagtaggccaatcttatattacttccatcgcaacgacattgcttgctacgtcacatgct
atctggataataataagaataagaccacaagtgattttttgcaatggtccagggacatgc
attcctctgtgtgtctcggcttttcttctgaaggtgcttggtttgggatggtcctccatt
ttctacatcgaaagcattgcaagagtgaagaagctttcattaagcggtttactgttgtac
aagctacgaatagctgatcagttcttcgtgcagtggccccagctgcagcaaaaataccct
cgagcatgctatgccggccgtttaatgtaa

DBGET integrated database retrieval system