KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329339
Entry
4329339           CDS       T01015                                 
Name
(RefSeq) cysteine proteinase 1
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4329339
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4329339
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     4329339
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C1: papain family
   4329339
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 4329339
NCBI-ProteinID: XP_015624643
UniProt: Q0E196 Q6K7A3
LinkDB
Position
2:15891533..15895228
AA seq 373 aa
MDHRLLLLGLLLLSPAVAAASVPGEEEPLIRQVVGGGDDNELELNAERHFASFVQRFGKS
YRDADEHAYRLSVFKANLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRAYLGLRTSRRAF
LRGLGGSAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLAT
GKMDVLSEQQMVDCDHECDSSEPDSCDAGCNGGLMTNAFSYLLKSGGLESEKDYPYTGRD
GTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLAIGINAAYMQTYIGGVSCPYICG
RHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDS
MVSTVSAIHTSKE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggatcaccgcctcctcctcctcggcctcctcctcctctccccggcggtggccgccgcc
tcagtccccggcgaggaggagccgctgatccggcaggtggtcggcggcggcgacgacaac
gagctggagctgaacgcggagcgccacttcgccagcttcgtccagaggttcgggaagtcc
taccgtgacgccgacgagcacgcgtaccggctctccgtgttcaaggccaacctccgccgc
gcgcgccgccaccagctgctcgacccctccgcggagcacggcgtcaccaagttctccgac
ctcaccccggccgagttccgccgggcctacctcggcctccgcacgtcgcgccgcgccttc
ctgcgggggctcggcgggtccgcccacgaggcgcccgtcctccccaccgacggcctcccc
gacgacttcgactggagagaccacggcgccgtcggccccgtcaagaaccagggatcgtgc
gggtcgtgctggtcgttcagcgcgtcgggggcgctagagggagcgaactacctggcgacg
ggcaagatggacgtgctctccgagcagcagatggtcgattgcgaccatgagtgtgattca
tcagaacctgattcatgtgatgctggatgcaatggtggattgatgactaacgccttcagc
tatcttttgaaatccggtggccttgagagtgagaaggattacccctacactgggagggat
ggcacctgcaaatttgacaagtcgaagattgttacttcagttcagaacttcagtgttgtc
tctgtcgatgaggatcagattgctgccaaccttgtcaaacatgggccacttgcaattggc
atcaatgctgcgtacatgcaaacatacattggtggtgtttcgtgcccgtacatctgtggc
aggcaccttgatcacggtgttcttctcgttggctacggcgcatctggttttgctccaatc
cgcctaaaggataaggcctactggatcatcaagaactcctggggcgagaactggggagag
catgggtactacaagatctgcaggggctccaacgtccgcaacaaatgtggcgtggattct
atggtctccaccgtgtctgccatccacacctcaaaggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335455
Entry
4335455           CDS       T01015                                 
Name
(RefSeq) cysteine proteinase 1
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4335455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4335455
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     4335455
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C1: papain family
   4335455
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 DUF4179
Other DBs
NCBI-GeneID: 4335455
NCBI-ProteinID: XP_015636152
UniProt: Q7XW09
LinkDB
Position
4:14129580..14132216
AA seq 381 aa
MARHRHRLAAAAALLLLLLSSAAALSSSAAEGEEDPLIEQVVGGGEEEDAQLDAEAHFAS
FERRFGRTYRDAGERAYRMSVFAANLRRARRHQRLDPTATHGVTKFSDLTPGEFRDRFLG
LRRPSLEGLVGGEPHEAPILPTDGLPDDFDWREHGAVGPVKDQGSCGSCWSFSTSGALEG
AHFLATGKLEVLSEQQMVDCDHECDASESRACDSGCNGGLMTTAFSYLMKSGGLQSEKDY
PYAGRENTCKFDKSKIVAQVKNFSVISVNEDQIAANLVKHGPLAIAINAAYMQTYIGGVS
CPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKN
KCGVDSMVSSVTAIHTSKKEE
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcgcgccaccgccaccgcctcgccgccgccgcggcgctcctcctcctcctcctctcc
tccgccgccgcgctgtcgtcatcggcggcggagggggaggaggacccgctcatcgagcag
gtggtcggcggcggggaggaggaggacgcgcagctggacgcggaggcgcacttcgcgagc
ttcgagcggcggttcgggcggacgtaccgggacgccggcgagcgcgcgtaccggatgtcc
gtgttcgccgccaacctccgccgcgcgcggcggcaccagcggctggaccccaccgcgacg
cacggcgtcaccaagttctccgacctcaccccgggcgagttccgcgaccgcttcctcggc
ctccgccgcccatccctggagggcctcgtcggcggggagccgcacgaggcccccatcctc
cccaccgacggcctccccgacgacttcgactggcgcgagcacggcgccgtcggccccgtc
aaggaccagggttcgtgcggatcgtgctggtcgttcagcacgtcgggggcgctggagggg
gcgcacttcctcgccacggggaagctggaggtgctcagcgagcagcagatggtcgactgc
gaccacgagtgtgatgcatcagaatcgcgcgcatgcgactcaggatgcaacggtggcttg
atgaccacagccttcagctacctcatgaaatccggtggcctacagagcgagaaagattac
ccgtacgctggacgagaaaacacctgcaagttcgacaagtccaaaatcgttgcccaagta
aagaacttcagtgtgatctccgtcaacgaagatcaaattgctgccaacctcgtcaaacat
ggccctcttgcaattgcaatcaatgcggcctacatgcagacatacatcggcggcgtgtcg
tgccccttcatctgtgggaggcaccttgaccatggtgtcctccttgttggctacggatcg
gcaggatacgcaccgatccgcttcaaggagaagccgtactggatcatcaagaactcgtgg
ggcgagaactggggggagaaggggtactacaagatctgcaggggacctcatgacaagaac
aagtgcggtgttgattccatggtctcctcagtgactgccatccatacctccaaaaaggag
gagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343231
Entry
4343231           CDS       T01015                                 
Name
(RefSeq) probable cysteine proteinase A494
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4343231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4343231
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     4343231
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C1: papain family
   4343231
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 4343231
NCBI-ProteinID: XP_015645418
UniProt: Q8GVR2 A0A0P0X6D7
LinkDB
Position
7:17496491..17498046
AA seq 376 aa
MAAAPARLVVLVLVAVVVVVGGDGDAGVIRQVTDGGYWPPGLLPEAQFAAFVRRHGREYS
GPEEYARRLRVFAANLARAAAHQALDPTARHGVTPFSDLTREEFEARLTGLAADVGDDVR
RRPMPSAAPATEEEVSGLPASFDWRDRGAVTDVKMQGACGSCWAFSTTGAVEGANFLATG
NLLDLSEQQLVDCDHTCDAEKKTECDSGCGGGLMTNAYAYLMSSGGLMEQSAYPYTGAQG
TCRFDANRVAVRVANFTVVAPPGGNDGDGDAQMRAALVRHGPLAVGLNAAYMQTYVGGVS
CPLVCPRAWVNHGVLLVGYGERGFAALRLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVC
GVDTMVSAVAVAPPPP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggctgctgcacctgcacggctcgtcgtccttgtcctcgtggcggtcgtcgtcgtcgtc
ggcggcgacggcgacgccggcgtcatccggcaggtgacggacggcgggtactggccgccg
gggctgctcccggaggcccagttcgcggcgttcgtgcggcggcacgggcgggagtactcc
gggccggaggagtacgcgcggcggctgcgcgtgttcgccgccaacctcgcccgcgccgcg
gcgcaccaggcgctcgacccgaccgcgcgccacggcgtcaccccgttctccgacctcacc
cgggaggagttcgaggcgcgcttgacgggcctcgccgccgacgttggcgacgacgtccgg
aggcggccgatgccgtccgccgcgccggccacggaggaggaggtgtccggcctccccgcc
agcttcgactggcgtgacaggggcgccgtgaccgacgtcaagatgcagggcgcgtgcggc
tcctgctgggccttcagcaccaccggcgccgtcgagggcgccaacttcctcgccaccggc
aacctcctcgacctcagcgagcagcagctcgtcgactgcgaccacacgtgcgacgcggag
aagaagacggagtgcgacagcgggtgcggcggcgggctgatgacgaacgcctacgcctac
ctgatgagctcgggggggctgatggagcagagcgcgtacccatacacgggcgcgcagggg
acgtgccggttcgacgccaaccgggtcgccgtccgcgtcgccaacttcaccgtcgtcgcg
ccgccgggcggcaacgacggcgacggcgacgcgcagatgcgggcggcgctggtgcggcac
ggcccgctagccgtgggtctgaacgcggcgtacatgcagacgtacgtgggcggggtgtcg
tgcccgctggtgtgcccgcgcgcgtgggtgaaccacggcgtgctcctcgtcggctacggc
gagcgtgggttcgcggcgctgcggctgggccaccgcccctactggatcatcaagaactcg
tgggggaaggcgtggggggagcagggctactaccggctctgccgcggccgcaacgtctgc
ggcgtcgacaccatggtctccgccgtcgctgtcgccccgccgccgccgtga

DBGET integrated database retrieval system