KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329349
Entry
4329349           CDS       T01015                                 
Name
(RefSeq) riboflavin biosynthesis protein PYRR, chloroplastic isoform X1
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4329349
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     4329349
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     4329349
SSDB
Motif
Pfam: RibD_C NADAR dCMP_cyt_deam_1 Glyco_hydro_79n
Other DBs
NCBI-GeneID: 4329349
NCBI-ProteinID: XP_015622579
UniProt: Q6K6I4
LinkDB
Position
2:complement(16104634..16110793)
AA seq 622 aa
MPPAHPPPCGVAPAAAATCPLFLLPRRSLSRSLHLRLRRLSLPAPRAASHAHDAVLLRRA
ADAADRSAGLTSPHPNFGCVIARPQLETDNAEAWVVGEGFLYAQGTPCAELLAAQEAGEH
ARGATAYLNLEPGDCYGDSTAVSTLVQAGITRVVVGLRHPLKHLRGKAIQSLRNEGIQVD
VVGEDLHSKLFKEALKSCLIVNAPLLYRAAFRVPFSVLKYAMTADGKIAASSGHASWVSG
KSSRGRVFELRGRSDAIIVGGNTVRLDDPRLTARHVKGHVPVRIVMSQSLNLPEEANLWN
VHDAYTIVATQRGARRDLQKKLALKGVEVVEFDMLNPRDVMSYCYDRGYLSVLWECGGTL
AASAISASVIHKVYAFLAPKIIGGVNAPTPVGELGMNQMTQAIDLIDVSYEQIDRDMLMS
GFIQPIPDLSPVIPSVDEMPSVDPEVSPYETNIISFYKTWDTFGAFSNFSPHPIHMPDEN
GDYFTWPTVEHYYQAHKFIGVDDPQAREIVQEIKLAKSPEEAARIGRTRQREFQELVRPD
WDSIKIEVMYRATKRKFSTYSHLTDMLLSTAGSVLVEASPHDLFWGGGREGEGMNYLGRL
LMQLRSEILGTIQTAVEVGEPA
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctccggcgcatccgcctccgtgcggggtcgcgcccgccgcggcggcgacctgcccc
ctcttcctcctcccccgccggagcctgagccggagcctccacctccgcctccgccgcctc
tccctccccgccccgcgcgccgcctcccacgcccacgacgccgtcctccttcgccgcgcc
gccgacgcggccgaccgctccgcggggctcacctccccgcaccccaacttcgggtgcgtc
atcgccaggccccagctcgagaccgacaacgccgaggcatgggtggtgggcgaggggttc
ctctacgcgcagggcacgccctgcgccgagctcctcgccgcccaggaggccggcgagcac
gcccgcggcgccacggcctacctcaacctcgagcccggggactgctacggggacagcact
gccgtttccaccctagtccaggcaggaattacaagggttgtggttggtcttaggcacccc
ttaaagcacctgagaggaaaggcaattcaatcactacgaaatgaaggcattcaagttgac
gttgtgggcgaggatctgcacagtaaattatttaaggaagctcttaagtcatgcctcatt
gtaaatgccccattactttaccgagctgccttccgtgttccgttctctgtcctgaagtat
gctatgactgcagatggaaaaattgcagcaagcagtgggcatgcatcttgggtaagtggc
aaatcatctagaggcagagtatttgaattgcgtggaagaagcgatgctataattgtaggt
ggaaatacagtacgccttgatgatcctcgcttaactgccaggcatgtcaaggggcatgtt
ccagtgcgaattgtaatgtcacagtctcttaatcttcccgaggaagcaaatttatggaat
gtacatgatgcatacacaatagttgcaacacaaagaggtgctcggagagatctccaaaag
aaacttgctttgaagggtgttgaagtagtggagtttgacatgctgaatcctagagatgtt
atgtcatattgttatgatcgtggttacctctccgtattatgggagtgtggtgggacccta
gcagcttctgctatatctgcaagtgttattcataaggtgtatgcattcttggctccaaaa
ataattgggggagtgaatgctccaacaccagtcggtgaactagggatgaatcaaatgact
caagcgattgatttaattgatgtttcttacgagcagattgatagggacatgctcatgagt
ggattcatccaacctattcctgatctctcacctgtaataccatctgtggatgaaatgcct
tcagttgatccagaagtatctccatatgaaactaatattatatccttctacaagacttgg
gatacctttggtgccttctctaacttttctccccatccaattcacatgcccgatgaaaat
ggagactatttcacatggccaacagtggagcactattaccaggcacacaagtttattggt
gttgatgatcctcaagcaagagagattgtccaagaaataaagctggctaagagtcctgaa
gaagctgctagaataggacgcactcggcaaagagaatttcaagaattggtacgaccagat
tgggattccatcaaaattgaagtgatgtacagagctacaaagcgcaagttctcaacttat
tcccatctgactgacatgctgttgtcaacggctggctctgttcttgttgaggcgtcgccc
cacgatttattttggggcggtgggcgcgagggcgaaggtatgaattacttgggtagattg
ctgatgcaattgcgatcagagattctaggaacaattcaaacagctgttgaggtaggggag
ccagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331409
Entry
4331409           CDS       T01015                                 
Name
(RefSeq) riboflavin biosynthesis protein PYRD, chloroplastic
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4331409
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     4331409
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     4331409
SSDB
Motif
Pfam: Glyco_hydro_16 dCMP_cyt_deam_1 MafB19-deam Inv-AAD Laminin_G_3 APOBEC_N
Other DBs
NCBI-GeneID: 4331409
NCBI-ProteinID: XP_015630824
LinkDB
Position
3:960413..962565
AA seq 712 aa
MRPYRNHLAFYHTNGSLDWGSLLCATDMASSLVSRTHLTPRPAAAASTASPCSARFAVRR
RRGLVGGVRCQAQASDMDGHYMRRCVELARKAAGHTSPNPMVGCVVVRDGRVVGEGFHPK
AGQPHAEVFALRDAGDLAENATAYVSLEPCNHYGRTPPCTEALINAKVKDVVVGMTDPNP
IVASKGIERLRSAGIDVRLCVDEEASCRKLNEAYIHRMLTGKAFATLRTTLSMNGVVINQ
IGSGADQPEGYYSQLLKEYDGVIISSNFAKTNTLPVSREAGAKQPLYIIIAQCENSQLNI
PFLKEERAAEAVVLSDSPITVEPAGVDVLVLDQMNLDAILQLLAQRGLCSVLVDFREAGG
GIASLLNNFQDDKLVQKVVVELLPVWAVSKGPSDLAFGGSQSFPLKDVEHSEPPHVHVHL
HPDGTEPLAHIAVDYCPEACHHASEDGEIHVTYDDRGGARWRSRCRFLPGGAVAATIRAP
AGDTAGLNYNLYLSSLEGSRDMDEIDFEFLGHDKCAVQTNFHVAGGGGREQIHVLPFDSS
DGFHHYAIAWGADAIEWRIDGELIRREERVAGEPWPEKPMFLYASVWDASHINDGKWTGT
YHGRDAPYVCSYRDIRVPLALSLEDEEDPYKCACVGDASAAIAAADAAEQVDAGDAPAAA
AAADAAEEVDAGDAPAATAAADVAEQVDAGDVPASAAAADAVKEVDAGAGKD
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgaggccgtaccgtaaccacctcgctttctatcacacaaacggctcgttggattggggg
agtctcctctgcgcgacggacatggcctcctcgctcgtctcgcgcacccacctcactccg
cgccccgccgccgccgcctcgacggcctctccttgcagcgcccgcttcgcggtccggcgg
cgccgtggcctcgtcggcggtgtgcggtgccaggcgcaggcgagcgacatggacggccac
tacatgcggcggtgcgtggagctggcgcgcaaggcggccggacacaccagccctaacccc
atggtcggctgtgtcgttgtccgcgacggccgcgtcgtcggcgagggattccatcccaaa
gccggccagccccacgccgaggtgtttgctctgagagatgctggggatttagcagagaat
gcaacagcctatgtgagcttagagccctgcaaccattacgggcggacacctccctgcact
gaagcactcatcaatgccaaagttaaagatgttgtggtggggatgactgacccaaatcct
attgtggcatccaaggggattgaaaggctcagaagcgccgggatagatgtgaggttgtgc
gtggatgaagaagcgtcatgccgcaagctaaatgaggcttacatccatcgcatgcttact
gggaaggcctttgcaactttaagaactacactctcgatgaatggagttgtcatcaatcag
attgggagtggagctgatcaaccagaaggatactactcgcagttattgaaagaatacgat
ggagtaataatttcaagcaattttgccaagacaaataccttgcctgtatcccgtgaagct
ggtgcgaagcagcctctttatatcatcatagcgcagtgcgaaaattcccaattaaacatt
ccgtttctcaaagaagagcgtgcagccgaggcagtagttctgtcggatagtcctatcact
gtggagccagcaggagttgatgttttagtccttgatcagatgaacctggatgccattctt
caacttcttgcacaacgagggctatgtagtgtgctggtggatttcagggaggctggagga
ggcattgcatcacttctgaacaattttcaggatgacaagctggtacagaaggttgttgtg
gagctcctgcctgtctgggcggtcagcaaagggccgagcgacctggcgtttggtgggagc
cagtcatttccactgaaggatgtggagcacagtgagccgccgcacgtgcacgtgcacctg
caccccgacggcacggagccactggcccacatcgccgtcgactactgccccgaggcctgc
caccacgcctccgaggacggcgagatccacgtcacctacgacgaccgcggcggcgcgcgc
tggcggtcccgctgccgcttcctcccaggcggcgccgtcgccgccaccatccgcgcgccg
gccggggacaccgccggcctcaactacaacctctacctctcctccctcgagggctcccgc
gacatggacgagatcgacttcgagttcctcggccacgacaagtgcgccgtgcagaccaac
ttccacgtcgccggcggcggcgggagggagcagatccacgtcctcccgttcgactcctcc
gacggattccaccactacgccatcgcctggggcgccgacgccatcgagtggcgcatcgac
ggcgagctgatccggagggaggagcgcgtcgccggcgagccgtggccggagaaacccatg
ttcctgtacgcgtccgtgtgggacgccagccacatcaacgacgggaagtggaccggcacc
taccacggccgcgacgcgccatacgtctgcagctacagggatatcagggtgccccttgcg
ctctcgttggaagacgaggaagatccatacaagtgtgcatgtgtaggagatgcgtctgct
gccatcgccgccgccgatgctgcggaacaggtggatgctggagatgcgcctgctgccgcc
gccgccgctgatgctgcggaagaggtggatgccggggatgcgcctgctgccaccgcggcc
gccgatgttgcggaacaggtggatgccggagatgtgcctgcttccgccgccgccgctgat
gctgtgaaagaggtggacgccggagctggtaaagattag

DBGET integrated database retrieval system