KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329363
Entry
4329363           CDS       T01015                                 
Name
(RefSeq) dCTP pyrophosphatase 1
  KO
K16904  dCTP diphosphatase [EC:3.6.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4329363
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.12  dCTP diphosphatase
     4329363
SSDB
Motif
Pfam: MazG-like MazG
Other DBs
NCBI-GeneID: 4329363
NCBI-ProteinID: XP_015623676
UniProt: A3A6U9 Q7XXQ3
LinkDB
Position
2:complement(16464968..16468498)
AA seq 172 aa
MNGVEVVGEGRGGRDAEAAATVGLEELRRRMADFARERDWEQFHSPRNLLLALVGEVGEL
SEIFQWKGEVPKGLPGWDEAEKVHLGEELADVLLYLVRLSDMCGVDLGSAALRKLEINAR
KYPASQCKGSSKKHTYYSSRCDVSGNSNGTNHLTSNEEHDNNTSSNNDNNGV
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaacggcgtcgaggtggtgggagagggccgcggcggccgcgacgccgaggcggcggcg
acggtggggctggaggagctgcggaggaggatggcggacttcgccagggagagggattgg
gagcagttccactccccaaggaacctcctcctcgccctggtaggggaggtaggagagctc
tctgagatattccagtggaaaggggaggtgcccaaggggctccccggctgggacgaggcg
gagaaggtgcacttgggggaggagctggccgatgtgctcctctacctcgtcaggctgtcg
gacatgtgcggagtcgatcttggcagcgctgctctacgcaagctggagatcaatgcacgc
aagtacccagcaagccagtgcaagggctcatccaagaagcatacctactacagctccaga
tgcgatgttagtggtaacagcaacggcaccaaccatctcacctctaacgaggagcatgac
aacaacaccagcagcaacaacgacaacaatggagtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335533
Entry
4335533           CDS       T01015                                 
Name
(RefSeq) dCTP pyrophosphatase 1
  KO
K16904  dCTP diphosphatase [EC:3.6.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4335533
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.12  dCTP diphosphatase
     4335533
SSDB
Motif
Pfam: MazG MazG-like
Other DBs
NCBI-GeneID: 4335533
NCBI-ProteinID: XP_015633864
UniProt: A0A0P0W8Z0
LinkDB
Position
4:16495126..16497743
AA seq 172 aa
MNGAVVGLGETAKGSGGGGGGGEVTLETLRRKMSEFARERDWEQFHSPRNLLLALVGEVG
ELSEVFQWKGEVPKGLPGWGEREVEHLGEELADVLLYLIRLSDMCDVDLGKAALRKMELN
ARKYPIGQCRGSSKKHTHYSTTTTTTDNGASGDDNNRNAGAGADADAGKEQC
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaatggtgctgtggtggggttgggggagacggccaagggcagcggcggcggcggcggc
ggaggagaggtgacgctggagacgctgaggaggaagatgtcggagttcgccagggagagg
gattgggagcagttccacagccccaggaaccttctcctcgctctggtgggtgaggtgggg
gagctctcggaggtcttccagtggaagggggaggtgcccaaggggctccctgggtggggg
gagagggaggtggagcacctaggcgaggagctcgccgatgtgctcctctacctcatccgc
ctctctgacatgtgcgatgtcgaccttggcaaggcagcgctgcgtaagatggagctcaat
gcgcgcaaataccccatcgggcagtgcaggggatcctccaagaagcacacccactactcc
accaccaccaccaccaccgacaacggtgcttccggtgatgacaacaaccgcaatgctggt
gccggtgccgatgccgatgccggcaaggaacagtgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336398
Entry
4336398           CDS       T01015                                 
Name
(RefSeq) dCTP pyrophosphatase 1
  KO
K16904  dCTP diphosphatase [EC:3.6.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4336398
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.12  dCTP diphosphatase
     4336398
SSDB
Motif
Pfam: MazG-like MazG dUTPase_2 COX16
Other DBs
NCBI-GeneID: 4336398
NCBI-ProteinID: XP_015636846
UniProt: A0A0P0WCE3 Q7X6K1
LinkDB
Position
4:25753636..25756585
AA seq 137 aa
MEVEKKATTVEEVRGVEEETKKEEAAASDVSLKELSKKLDDFAKERDWEMYHAPRNLLLA
MIAEVGELSELFMWKGEVAKGLPGWKESEKEHLGEELSDVLLYLIRLSDMCGVDLGDAAT
RKIVKNAVKYPAPSKST
NT seq 414 nt   +upstreamnt  +downstreamnt
atggaggtcgagaagaaggcgacgaccgtggaggaggtgagaggggtggaggaggagacg
aagaaggaggaggcggcggcttctgacgtgagcctgaaggagctgtccaagaagctcgat
gacttcgccaaggagagggactgggagatgtaccatgccccgaggaaccttctgcttgcc
atgatcgctgaggtcggggagctgtcggagctgttcatgtggaaaggggaggtggccaag
ggcctgcccgggtggaaggagtcggagaaggagcacctcggcgaggagctctccgacgtg
ctgctctacctgatccggctctccgacatgtgcggcgtcgacctcggcgacgccgccacc
aggaagatcgtcaagaacgccgtcaagtacccagcgccgtcgaagagcacttga

DBGET integrated database retrieval system