KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329381
Entry
4329381           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S8
  KO
K02995  small subunit ribosomal protein S8e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329381
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329381
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4329381
  Archaea
    4329381
SSDB
Motif
Pfam: Ribosomal_S8e
Other DBs
NCBI-GeneID: 4329381
NCBI-ProteinID: XP_015627504
UniProt: P49199
LinkDB
Position
2:17035569..17038108
AA seq 220 aa
MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR
LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV
DIGRKKKAPAAKKDAEGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRLL
ACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGASA
NT seq 663 nt   +upstreamnt  +downstreamnt
atgggtatctcgcgtgattccatgcacaagcgccgcgccacgggcggcaagcagaaggca
tggcgcaagaagcgaaagtatgagctcggaaggcagcctgccaacaccaagctgtcaagc
aacaagacagtgaggagggtgcgtgtccgtggaggtaatgtgaaatggagggccctccgt
ttggatactggcaactactcatggggaagtgaggccgtgacccgcaagacccgtatcctt
gatgtggtctacaatgcatccaacaatgagcttgtcaggactcagacccttgtaaagagt
gctattgtgcaagttgatgctgcccccttcaagcagtggtacctcactcactatggagtg
gatattggtagaaagaagaaggctcctgcagccaagaaggatgctgaggggcaggatgct
gaagctaccacagaggaagcgaagaaaagcaaccatgttgtcaggaagcttgagaagcgc
caacagggacgcacacttgacgcccacatcgaagaacagtttggcagtgggaggttgctg
gcctgcatttcttcccgccctgggcagtgtggccgagcagatggctatatccttgagggc
aaagagctggaattctacatgaagaagctccagaggaagaagggcaagggtgcctcagct
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335547
Entry
4335547           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S8-like
  KO
K02995  small subunit ribosomal protein S8e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335547
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335547
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4335547
  Archaea
    4335547
SSDB
Motif
Pfam: Ribosomal_S8e
Other DBs
NCBI-GeneID: 4335547
NCBI-ProteinID: XP_015636562
UniProt: A3ASN4 Q0JDZ7
LinkDB
Position
4:complement(16645714..16648395)
AA seq 221 aa
MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR
LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV
DIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGRL
LACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGAAA
NT seq 666 nt   +upstreamnt  +downstreamnt
atgggtatctcgcgtgactccatgcacaagcgccgggccaccggtgggaagcagaaagcg
tggaggaagaagcgaaagtatgagcttggtcgccagccggcaaacaccaagttgtcgagc
aacaagacagtgaggagggtccgtgttcgtggaggaaatctgaagtggagggctcttcgc
ctggatactggtaactattcttggggaagtgaggctgtcactcgcaagacccgtatcctt
gatgtggtctacaatgcgtcaaacaatgagcttgtgaggacccagacccttgtgaagagt
gccattgtgcaagttgatgctgccccattcaagcagtggtatctcactcactatggtgtc
gatatcggtaggaagaagaaagctcctgctgctaagaaggatgctgctgagggacaagag
ggtgaggctgccacggaggaagcaaaaaagagcaaccatgttgtgaggaagcttgaaaag
cgtcagcaaactcgcactctggactcgcacattgaagagcaatttggcagcggaaggctc
ttggcctgcatctcctcccggcctgggcaatgtggcagagctgatgggtacatcctggag
ggcaaagagcttgagttctacatgaagaagctccagaggaagaagggcaagggtgctgca
gcttag

DBGET integrated database retrieval system