KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329416
Entry
4329416           CDS       T01015                                 
Name
(RefSeq) galacturonosyltransferase 8
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4329416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329416
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4329416
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4329416
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24 SurA_N_3
Other DBs
NCBI-GeneID: 4329416
NCBI-ProteinID: XP_015626990
UniProt: A0A0P0VJA7
LinkDB
Position
2:complement(17559228..17562840)
AA seq 533 aa
MGGRGALPVVAGVVLVLLVVAARGASAAGGGGGGGAAAAAVNGDRLRAEQIRKQAKDAAA
SAAALAAASRRLHLDRARHLRLLSSLHRNLTATLRDLSAAASASASASASEAGYASAGDE
VRRLDLQAKDLIRAARAAIADAKPLFDPQLKIQRLKDAIFAQNELLARAKKRGAFASLIA
AKSIPKPLHCLAVRLTAERIARPENYADPVPPPHALEDPAMFHYAIFSDNVLAASVVVRS
AVANSLDPSKHVFHVVTDRMNLGAMQVIIRLMDLKGAHYEVKAFEDYKFLNSSYVPVLRQ
LESANLQKFYFENKLENATKDASNMKFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDV
VVQRDLTGLWKIDMDGKVNGAVETCFGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNF
FDLDSWRREKSTEQYHYWQSQNENRTLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNP
SISMEEIRNAAVVHFNGNMKPWLDIGMNQFRHLWTKYVDYDDSFIRQCNFAPP
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggtggacgcggcgcgctaccggtggtcgcgggggtcgtgcttgtcctcctggtggtc
gcggcgcggggagcctccgccgctggaggtggaggtggtggtggggcggcggcggcggct
gtcaacggggaccggctcagggcggagcagatccggaagcaggcgaaggacgcggcggcc
tccgccgccgcgctggccgcggcgtcgcgcaggctccacctcgaccgcgcgcgccacctc
cggctgctctcctccctccaccgcaacctcaccgccacgctccgtgacctcagcgccgcc
gcgtcggcgtcggcgtccgcgtccgcgtccgaggccggctacgcgtcggcgggggacgag
gtgcggcggctcgaccttcaggccaaggacctgatccgcgccgcgcgcgccgccatcgcg
gacgccaagccgctgttcgacccgcagctcaagatccagcggctcaaggacgccatcttc
gcgcagaacgagttgctcgcgcgcgccaagaagcgcggcgccttcgcctccctcatcgcc
gccaagtccatccccaagccgctccactgcctcgccgtccgcctcaccgccgagcggatc
gcacggcccgagaattacgccgacccggtgccgccgccgcacgcgctcgaggaccccgcc
atgttccactacgccatcttctccgacaacgtcctcgccgcctccgtcgtcgtgcgctcc
gccgtcgccaactcgctcgacccctccaagcacgtcttccacgtcgtcaccgaccgaatg
aaccttggcgccatgcaggtgataattcgcctaatggacttaaaaggcgcgcactatgag
gtcaaagcatttgaagactacaagtttcttaactcctcatatgttcctgtgcttcggcaa
ctggagtcagcaaacctccagaagttctattttgagaacaagcttgagaatgctacaaaa
gatgctagtaatatgaagtttaggaaccccaagtatctctcgatgctcaatcacttgcgg
ttctatttgccggagatgtacccaaagctgcaccggatacttttcttggatgatgatgtt
gtggtacagcgggatcttacaggattgtggaagattgacatggatgggaaggtgaatgga
gcagtggaaacatgctttggatcgtttcatcggtattggcagtatatgaacttctcgcac
ccacttatcaaagagaagtttaatcctaatgcatgtggatgggcatatggcatgaacttc
tttgatcttgattcttggaggagagaaaagagtactgagcaatatcattactggcagagt
cagaatgagaacaggacattatggaagctaggaacgttgcctcctggtttgatcacattc
tactccaccacaaagcctctggaaaaatcttggcatgttcttggactcgggtacaatcca
agcataagcatggaggagattagaaacgctgctgttgtgcatttcaacgggaacatgaag
ccctggctggatatcggtatgaaccagttcaggcacctatggacaaaatacgtggattac
gacgactcattcattcgccaatgcaattttgcaccaccgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330716
Entry
4330716           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 9
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4330716
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4330716
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4330716
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4330716
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4330716
NCBI-ProteinID: XP_015623438
UniProt: Q0DXL4 Q6ZGT9
LinkDB
Position
2:31284717..31286683
AA seq 493 aa
MAGGGGGGRASAQRRAALAALITLLLLASLAFLLSATGTASAPNSAPFRLAAIRRHAEDH
AAVLAAYAAQARKLSAASASQTESFLSISGHLSSLSSRISLSTVALLEKETRGQIKRARS
LAGAAKEAFDTQSKIQKLSDTVFAVDQQLLRARRAGLLNSRIAAGSTPKSLHCLVMRLLE
ARLANASAIPDDPPVPPPQFTDPALYHYAIFSDNVLAVSVVVASAARAAAEPARHVFHVV
TAPMYLPAFRVWFARRPPPLGTHVQLLAVSDFPFLNASASPVIRQIEDGNRDVPLLDYLR
FYLPEMFPALRRVVLLEDDVVVQRDLAGLWRVDLGGKVNAALETCFGGFRRYGKHINFSD
PAVQERFNPRACAWSYGLNVFDLQAWRRDQCTQRFHQLMEMNENGTLWDPASVLPAGLMT
FYGNTRPLDKSWHVMGLGYNPHIRPEDIKGAAVIHFNGNMKPWLDVAFNQYKHLWTKYVD
TEMEFLTLCNFGL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcaggcggcggcggcggcggcagagcttccgcgcagcggcgggcggcgctcgcggcg
ctgatcacgctcctcttgcttgcgtccctcgctttcctcctgtcggcgacgggcaccgcc
tccgccccgaactccgcacccttccggctggccgccattcgccgccacgccgaggaccac
gccgccgttctcgccgcctacgcggcccaggcgcggaaactcagcgcggcctccgcctcc
cagacggagtctttcttgtctatctccgggcatctcagctcgctctcgtcccgcatctcc
ctgtccaccgtcgcgctcttggagaaggagacgcgcgggcaaatcaagcgcgcccgctcc
ctggcaggcgccgccaaggaggcgttcgacacgcagtccaagatccagaagctctccgac
accgtcttcgccgtcgaccagcagctcctccgcgcccgccgcgcgggcctcctcaactcc
cgcatcgccgccggctccacgcccaagtcgctccactgcctcgtcatgcgcctcctcgag
gcacgcctcgccaacgcctccgccatccccgacgacccgcccgtcccgccccctcagttc
accgacccggcgctgtaccactacgccatcttctccgacaacgtgctcgccgtgtccgtc
gtggtggcctccgcggcgcgcgcagccgccgagccggcgcgccacgtcttccacgtggtc
accgcgcccatgtacctcccggccttccgcgtctggttcgcgcgccggccgccgccgctc
ggcacgcacgtgcagctcctcgccgtctcggacttcccgttcctgaacgcctccgcctcc
ccggtcatcaggcagatcgaggacggcaacagggacgtgccgctgctcgactacctccgg
ttctacctcccggagatgttcccggcgctgcggcgggtggtgctcctggaggacgacgtg
gtggtgcagagggacctggccgggctgtggcgcgtcgacctcggcggcaaggtgaacgcc
gcgctggagacctgcttcggagggttccgccgatacggcaagcacatcaacttctccgac
cccgccgtgcaggagcggttcaacccgcgcgcgtgcgcctggtcctacggcctcaacgtg
ttcgatctccaggcttggcgccgggaccaatgcacccagcgattccaccagctcatggaa
atgaacgagaacggcacgctgtgggatccagcgtccgttctgccggcggggctcatgacg
ttctacggcaacacgaggccgctggacaagtcgtggcacgtgatgggactcgggtacaac
ccgcacatcaggccggaggacatcaagggagccgcggtgatacacttcaacgggaacatg
aagccgtggctcgacgtcgccttcaaccagtacaagcatctctggaccaagtacgtcgac
accgagatggagttcctgacattgtgcaacttcggactctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332727
Entry
4332727           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 7
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332727
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4332727
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4332727
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24 MurT_C
Other DBs
NCBI-GeneID: 4332727
NCBI-ProteinID: XP_015628187
UniProt: Q10LZ0 Q0DS67
LinkDB
Position
3:complement(12133453..12138733)
AA seq 631 aa
MKATPPPAKRRRGPRLAVLALVFCSLLVPIAFLFNRFPAVYVTDERPQQEIDLPSFGRMG
LERSGGVTVVKPEDGSGANAETKDTPEMIHRGGINSHHHSDNVPSKVSANPKVPPPPKIE
PLKPKAKSVPVPVQRTEVISGNNMKPAKVQNADDVEKAKACQLEFGSYCLWSIEHKEVMK
DTIVKRLKDQLFVARSYYPSIAKLKGKEALTRGLKQNIQEHERVLSESIVDADLPSFIKS
KIEKMDQTIGRAKACTVDCSNVDRKLRQILHMTEDEAHFHMKQSAYLYNLGVHTMPKSHH
CLNMRLTVEYFKSAPLDSDDSAVHKFNVPDHRHYVILSKNVLAASVVINSTVSNSEETEN
VVFHILTDAQNFYAMKHWFGRNSYRESAVHVINYEHIILENLPEFSSQQLYLPEEFRVFI
SNLERPSEKTRMEYLSVFSHSHFFIPEILKDLKKVIVLDDDVVVQRDLSFLWNIDMGDKV
NGAVKFCGLRMGQLRNLLGKATYDPQSCAWMSGVNVIDLEKWREHNVTENYLQLLKKFQH
NDDEASVRAAALPISLLAFEHLIYPLDERLTISGLGYDYAIKEELVRNSVSLHYNGNMKP
WLELGIPDYRKYWKRFLTRDERFMDECNVSP
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaaggcgacgcccccgccggcgaagaggcggaggggcccgcggctggcggtgctggcg
ctcgtcttctgctcgctgctcgtgccgatcgccttcctcttcaaccgcttccctgccgtg
tatgtgacggatgagcgcccccaacaggagattgatttgccttcattcggacgcatgggg
ttggaaaggagcggtggagtaaccgtagtgaagccggaagatggcagtggtgctaacgca
gagacaaaggatacacctgagatgattcacaggggcggtataaactcacatcaccatagt
gataatgtcccttccaaagttagtgctaacccaaaagtcccccctccaccaaaaattgaa
ccactgaagccaaaggcaaagtcagtaccagttccagttcaacgtacagaagttattagt
ggcaataacatgaaacctgccaaagttcaaaatgcggacgatgtggaaaaggctaaggct
tgtcagcttgaatttgggagttactgcctctggtccatagagcacaaagaagttatgaaa
gacaccattgtgaaaagactaaaagatcagctatttgtagctcgctcgtactacccaagc
attgccaaactaaaaggaaaggaggcactgactcgtgggttgaagcaaaatattcaagaa
catgagagggttctcagtgagtccattgttgatgctgatctaccatcgtttatcaaaagc
aagatagagaagatggaccaaacaataggaagagctaaagcatgcactgttgattgtagc
aacgtcgacagaaagcttcgccaaatacttcatatgacagaggatgaagctcattttcat
atgaagcagagtgcatatctgtacaatcttggtgttcacacgatgcccaaaagtcatcat
tgccttaacatgaggttgacggtagaatattttaagtccgctccattggattcagatgac
tctgctgtgcataagtttaatgttccagaccataggcactatgtcatattatctaaaaat
gtacttgcagcttctgttgtcatcaactcaactgttagtaattctgaggagaccgaaaat
gtagtatttcatatattaactgacgctcaaaatttctatgccatgaagcactggtttgga
aggaactcctacagggagtcagctgttcatgtcataaactatgagcatattattttggag
aatttgcccgagttcagctcccagcaattatatttacccgaagaatttcgtgttttcatc
agtaatcttgaacgacctagtgagaaaaccagaatggaatatttatcagtgttcagtcac
tcacatttcttcatcccagaaatattaaaagatttaaagaaggtgattgtgttggatgat
gatgtggttgttcaacgtgatctctctttcttgtggaatattgatatgggagataaggtc
aatggtgctgtcaagttttgtggtctgagaatgggacaactaagaaaccttctgggtaaa
gcaacatatgatccgcagtcgtgtgcttggatgtctggggtgaatgtgattgatttggag
aaatggagggagcataatgtcacagagaattaccttcaactactgaaaaagttccaacac
aatgatgatgaagcttcagtgcgagctgcagctttgccaataagcttgcttgcctttgaa
catcttatatatcctctcgatgaaagattgactatatctgggcttggatatgactatgcc
atcaaagaggaacttgtccggaattctgtatcattgcattataacggtaatatgaagcct
tggcttgagttaggtataccggactacaggaagtactggaagaggtttcttacacgagat
gaacgattcatggatgagtgcaatgtaagtccataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333107
Entry
4333107           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 11
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4333107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4333107
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4333107
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4333107
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4333107
NCBI-ProteinID: XP_015632796
UniProt: Q75IZ5 A0A0P0VYS1
LinkDB
Position
3:complement(17109192..17113807)
AA seq 541 aa
MPPVRSAPGRRAPEFRRSSRRRLPEWIWWLVGIFLVLGLMLFVLHHNQREHFRPPVVDKG
SEFEETHHEKVNFTEELLSSTSFARQLTDQMTLAKAYVVLAKEHGNLQLAWELSSQIRNC
QRLLSEEAVSGKAITKEEAHPIITRLARLIYKAQDSHYDISTTIVTLKSLVNALEERAKA
AVVQTAEFGQLAAESVPKNLHCLTVKLTVEWLQNPKHRGRSEEHRNSTRLVDNNLYHFAI
FSDNVLATSVVVNSTVSNANHPQQLVFHVVTDRVHFGAMSTWFLINDFKGCTVEVRCIDE
FTWLNAAASPLVRQLSEMETQGFYYGDSKNLEREIKFHNPKFVSLLNHLRFYIPQILPNL
EKVVFLDDDVVVQKDLTQLFSIELHGNVIGAVETCLESFHRYHKYLNFSHPIISSKIDPH
TCGWAFGMNIFDLIAWRKANATALYHYWQEQNADLLLWRTGTLPAGLLTFYGLMEPLDRR
WHVLGLGYDVDIDDRLIESAAVVHYNGNMKPWLKLAIRRYKYIWERYVNFTHPYVRECLL
H
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgccccccgtcaggtccgcccccgggaggcgggcgccggaattccggcgctcgtcgcgg
cggcggctgccggagtggatctggtggctcgtcgggatcttcctcgtcctcggcctcatg
ctcttcgtcctgcaccacaaccagagggagcatttccgcccgcccgtagtcgataagggt
tcagaatttgaggaaacccatcatgagaaagtaaatttcacagaagagcttttaagcagt
acatcatttgcacgccaattgacagatcaaatgactctagcaaaggcttatgttgtcctt
gcaaaagagcatggcaaccttcagcttgcatgggagcttagttcacagataaggaattgt
caaagattgctatctgaagaagctgttagtgggaaggccatcactaaagaagaagcccat
ccaataataactcggcttgcacggttaatatacaaagcacaggactctcattatgatatc
agcacaacaattgtaacactgaagagccttgtcaatgcacttgaggagcgtgcaaaggca
gcagttgttcagactgctgagtttggtcagttagctgcagagtccgtccccaagaatttg
cactgtttaactgttaaactgacggtagagtggcttcagaacccaaaacataggggtcgc
tcagaagaacatcggaactccacacgattggtagacaataatctgtaccattttgccata
ttctctgataatgttcttgccacatcagttgttgtcaattctacagtctcaaatgcaaac
caccctcaacagcttgtatttcatgtggtcacagacagggtccactttggggctatgtca
acttggttcctcataaatgacttcaaagggtgcactgttgaagtccgctgcatagatgag
ttcacatggttgaatgctgctgcttctcctctggttaggcagctatctgagatggaaact
cagggtttctactatggtgattctaaaaatcttgaaagagaaataaagttccataatccc
aagtttgtttctctgttgaaccatttgcggttctacattcctcaaatactacctaatttg
gagaaggtggtttttctcgatgatgatgttgtggtacagaaggacttgacacagctattt
tcgatagagttgcacggtaatgttattggagcagtggagacttgtttagagtcatttcat
cggtatcacaagtatcttaatttctcccacccaattatcagctccaaaattgatccgcat
acttgtgggtgggcttttgggatgaacatctttgacttaatagcctggaggaaggcaaat
gccacagcactttatcattattggcaagagcaaaatgctgatctattgctctggaggaca
gggacacttcctgcaggccttttgacgttctatggcctgatggaacccctagatcgcaga
tggcatgtcttggggctaggatatgatgttgacatagatgatcgtttgattgagagtgcc
gctgtcgtgcactacaatgggaatatgaaaccatggctgaagttagccattcgtcggtac
aagtatatatgggagcggtatgtcaatttcacacacccatatgttagagagtgtttgttg
cattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337139
Entry
4337139           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 10
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4337139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4337139
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4337139
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4337139
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4337139
NCBI-ProteinID: XP_015636276
UniProt: A0A5S6RCG5 Q7XQR7
LinkDB
Position
4:32353483..32356054
AA seq 556 aa
MRRRPFLDQRRPSSFKRRWQQRPWWFRLAVTLLLALACLFLLLALRGSPDPDPVVLPSTD
SSRSAATTSPLLHQRSYLDGVTDAFNMTDEMLSAHSFSRQLMDQISLAKTYLVVAKEANN
LQFAAELSSQIRRAQSILAHAAAHGGTVTEQDAEKAIRDMSVLFFQAQQFRYDSAVTIMK
LKGQIQSLEEKSKAEAEKSTKYGQIAAEELPKGLYCLGVRLTMEWFKTTELQRKFTERSP
AVQSNLRDNSLYHYCVFSDNILAVSVVVNSTTLNSMRPEKIVFHLVTDEVNYAPMRAWFA
LNDYRGATVEIQKVEDFTWLNSSYVPVLKQLQDAATQNYYFSGSGNRGTPVKFRNPKYLS
MLNHLRFYIPEIYPELRKVVFLDDDIVVQKDLSELFTINLNGNVMGAVETCMETFHRFHK
YLNHSHPLIRAHFDPDACGWAFGMNVLDLVMWRNKNVTGIYHYWQERNADHTLWKLGSLP
PGLLAFYGLVEPLDPKWHVLGLGYTTVDPATIKEGAVLHYNGNMKPWLKIGMEKYKGFWD
NYVDYSHPLLQRCFTH
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaggcggcggccgttcctcgaccagcggcggccgtcgtcgttcaagcgccggtggcag
cagcgcccgtggtggttccgcctcgcggtcaccctcctcctcgccctcgcctgcctcttc
ctcctgctcgcgctccggggctcgcccgaccccgacccggtggtgctcccctccaccgac
tcgtccagatccgcggccaccacctcccctctcctccatcagagatcttacctcgatggc
gttacggatgcgttcaacatgaccgacgaaatgctgagtgctcactcgttttcaaggcag
cttatggaccagatttcccttgcaaaaacctacctcgtcgttgcgaaggaagccaataac
ctgcagtttgcagcagagcttagctcgcagatacggcgggcgcagagcatccttgcgcat
gctgcagcccatggtggcacggtgacggagcaggatgcggagaaggcaattagggacatg
tcggtgttgttcttccaggcgcagcagttccgctatgatagtgcagttacaatcatgaag
ttgaagggtcagattcaatccctagaggagaaatcgaaagctgaggcggaaaagagcacc
aagtatgggcagattgctgccgaggagcttccaaaggggctttactgccttggagtccgg
ttaaccatggaatggttcaagacaactgagctccagaggaagtttactgagaggagccca
gcagtacagagcaacctaagggataacagcctttaccattactgtgttttctcggacaac
atccttgctgtttctgttgtcgtcaattctacaactctaaattcaatgcgccctgaaaag
attgtttttcacttggtgactgacgaggtgaattatgctcccatgagggcgtggttcgcc
ctgaatgattacagaggagccactgtggagattcaaaaggtagaggatttcacttggctc
aattcatcgtatgttcctgttcttaaacagctccaggatgctgccacccagaactactac
ttctctggcagtggtaatcgtggaacaccagtcaaattcaggaaccctaagtacttatca
atgcttaaccacctgaggttctatatcccagaaatctatccagaattgcgtaaggtcgta
tttcttgatgatgacattgttgtccaaaaggacttgtcggaattgtttaccatcaacctc
aatggaaatgttatgggagctgtagagacttgcatggagacatttcacaggttccataag
tatcttaaccattcccatcctctaatccgtgctcattttgatcctgatgcctgtggctgg
gcatttggtatgaatgttcttgatcttgtgatgtggaggaataagaatgtgacaggtata
tatcattactggcaagagcgcaatgctgatcataccctatggaagcttggatctttacca
cctggtcttcttgctttctatggcttggttgagccattggaccccaaatggcatgtcttg
ggactgggctacacaacagtggatcccgctactatcaaagaaggtgcagtgttgcattac
aatggaaatatgaagccatggctaaaaattgggatggagaagtacaagggcttctgggat
aactatgtagactattcacaccctctgcttcagcggtgcttcacgcactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339139
Entry
4339139           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 7 isoform X1
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4339139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4339139
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4339139
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4339139
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24 DUF4179
Other DBs
NCBI-GeneID: 4339139
NCBI-ProteinID: XP_015637843
UniProt: B9FKU3
LinkDB
Position
5:complement(23873685..23878515)
AA seq 637 aa
MKGQGGGAGAPAKRRWRSVAAAAAALALLFLSVGVPLAVLLGLHQRFPSMYLADESAVSV
FGGSEGGGWEPNTSQENDRLPVNDTNKFPPSIEKDWSKTNTGNSDAESNGTNNQPSIDKP
ISNTSIHPGLPIKQIVIFDDISLLSNTDADPKDNFEQGLPGDESIKSCQLEFGSYCVWSV
EHKEVMKDSVVKRLKDQLFVARAYYPSIAKLEGMEKLSHEMKQSIQEHEHMLSEAICDAD
LPAFHGANMAKMEKTIAAAKSCLIECTNFEKKLRQLLDMTEDEAHFHARQGAYLYRLGVQ
TLPKSLHCLSMRLTVDYFKSFADMEYSNVQKLENPVLRHYVIFSTNLLASSMTVNSTVIN
SEESANVVFHLVTDAQNFYAFKNWFIRNSYKEATIGVLNFEDFQATHLDNRRVEHLSPYE
EFRIASHSNARIPNTQMRTEYISVFGHSLFLLPELFSNLKRVIVLEDDTIVQRDLSHIWN
LDLKGKVIGAVQSCRVRLRHLRPYLVDFPYDASSCIWMSGVSVIDLNKWREHDVTAVRNR
VLQKLQHGPEASWRAAVLPAGLLAFQNLVHPIEAQWIQSGLGHDYGVNHGAIKKAGILHY
NGNMKPWLELGIRRYRKYWRRYLPRDDPFLIDCNVNP
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagggccagggtggcggcgcgggggccccggcgaagaggcggtggaggagcgtggcg
gccgcggccgccgcgctggcgctgctgttcctctccgtcggcgtgccgctcgccgtgctg
ctcggcctccaccagcgcttcccgtccatgtatttggccgacgagagcgccgtgtcggtg
tttggcggcagcgagggtggtggttgggagccaaatacatcgcaggaaaatgacaggctg
ccagtcaacgacacgaacaaatttccgccatcgattgaaaaggactggagcaaaacaaat
accggtaattctgatgcagaaagcaatgggaccaacaatcaaccaagtattgacaaaccg
attagcaatacctcaatccatccaggccttcctatcaaacaaatcgtgatctttgatgat
atatcattactgagtaatactgatgctgatcctaaggacaattttgaacaaggtttacct
ggtgatgagagtataaaatcgtgccaactagaatttggaagctattgtgtttggtctgtt
gaacacaaggaagtgatgaaagattctgtagtgaagagacttaaagaccagctctttgtt
gcaagagcttactatccaagcatagcaaaacttgaggggatggaaaaactttcacatgaa
atgaagcaaagtatccaagagcatgagcacatgctcagcgaagccatatgtgatgctgat
cttcctgcattccatggagccaatatggcaaagatggagaagacaatagctgcagcaaaa
tcatgtctgatagaatgcactaattttgagaaaaaactgaggcaattgcttgatatgact
gaggatgaagctcattttcatgcaagacaaggtgcatatctttaccggcttggagttcag
acattacctaagagcctccactgcctttcaatgagattgacagtagactactttaaatcc
tttgctgacatggagtactccaatgtgcaaaagcttgaaaatccagttctccggcactat
gttattttctctaccaaccttcttgcatcttccatgactgtcaactcgactgtgataaat
tctgaggaatcagcaaatgtggtttttcatcttgttactgatgcacagaacttttatgca
tttaagaattggttcattagaaattcttacaaggaagccactatcggtgttctgaatttt
gaagatttccaagcaacacatttggataataggagagttgaacacttatcaccatatgag
gagttccgcatcgcttcccatagcaatgcccgaattccaaatacccaaatgagaactgaa
tatatttcagtgtttggacactctcttttcttgcttcctgagctgtttagcaatcttaaa
cgggtgattgttttggaagatgatactatagtccagagagacttgtcacacatatggaat
cttgatttgaaaggaaaagtgattggtgctgtacagtcttgtcgagttagattaaggcat
ctcagaccatacttggttgacttcccatatgatgctagttcatgtatctggatgtctgga
gtgagtgttattgatctcaataaatggagggagcatgatgtgactgcagttcgtaatcga
gtactccaaaagctgcaacatggccctgaagcgtcatggagagctgcggtgttacctgca
ggcctgcttgcttttcaaaatctggtccatcctattgaagcacagtggatccagtctggt
cttggtcatgactatggagtcaatcatggtgctataaagaaagctggcatattgcactac
aacggcaacatgaaaccgtggttagaactcggcatacggcgatacaggaaatattggaga
aggtacctgccaagggatgatccattcttgatagattgcaatgtgaatccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342125
Entry
4342125           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 3 isoform X1
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4342125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4342125
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4342125
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4342125
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4342125
NCBI-ProteinID: XP_015643074
LinkDB
Position
6:complement(30948367..30951485)
AA seq 675 aa
MFPLRRRPGFLAVVLLLLLFLSFQLLIHVPSVGSALSLCLFSDHHTERKGPGSCHGCRNV
QGMDDADKTIAYTDQDGRIKLFKVTMTEFLSSSIWKNPLQPKDTQPLAQTQEIAKEQLPD
TGSEISNISTTGTLETRRNDPIKLKRVVFRRKRKEDRTQELLQVDREAELNMRNVATDRS
RNFSNKVRASYNIWRPGFHHTNTDSTLRLMKDQIIMAKVYATIAHSQKQPDLYVLLMTCI
KQSQEGIGDAHMDYKLDLSALERAKAMGHALSSARDVLYNSGEVSRRLRVMLQSTELNID
SVKKQNSFLVQHAAKTVPMPLHCLHMQLTTDYHFRDGVVKEYFRDAALKEEEDKAKREDR
SLYHYAIFSDNVLAASVVVRSTVTHAKEPEKHVFHIVTDRLNFAAMTMWFISNPPLPATV
HVENIDNFKWLNSSYCSVLRQLESARLKEYYFKAHDPSSLSDGNENLKYRNPKYLSMLNH
LRFYMPEIHPKLDKILFLDDDVVVQKDLTPLWDVDLKGIVNGAVETCKESFHRFNTYLNF
SHPKISENFDPHACGWAFGMNMFDLKEWKKQNITGIYHYWQDLNEDRKLWKLDTLPPGLI
TFYNLTYPLNRTWHVLGLGYDPSVDLVEIENAAVVHYNGNYKPWLDLAISKYKPYWSKYV
DLDNSHIQRCYMSEQ
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgttcccgctccgccgccgccccggattcctcgccgtcgtccttctcctcctccttttc
ctctccttccagctcctgattcatgtcccctctgtcggatcggcactgtccctatgtctc
ttctccgatcaccacaccgagcgcaagggtcctgggagctgtcatggatgccgcaatgta
cagggcatggatgatgccgataagacgattgcttacacggaccaggatggtcggatcaag
ctcttcaaagttaccatgacagaattcctctcgtcctctatctggaagaatcctttgcaa
ccgaaagatacccaaccactagctcaaactcaagaaattgcgaaggagcagctaccagac
actgggtcagaaatctcaaatatttcaaccacaggaactttggaaaccagaagaaacgat
ccgattaaattaaagagagtggtattccgacgcaaaagaaaggaggataggacccaggag
ttgcttcaggtggacagggaggctgaactcaacatgagaaatgtggccacagacagatca
aggaacttcagtaataaagtaagagccagctacaacatatggaggccggggtttcaccat
actaacacagattcaaccctcagactcatgaaagatcagattataatggccaaggtgtat
gccacaattgcacattcccagaagcaacctgacctgtacgtgttgctcatgacatgcata
aaacaaagccaagaaggtattggggatgcacacatggattacaaacttgatttgagtgct
ttagagcgagcaaaagcaatggggcatgccctgtcttcagctagagatgttctgtacaac
tctggtgaagtatccagacgattgcgtgttatgctacagtctacagaactaaatatcgat
agtgttaagaagcagaactcattcctggtgcagcatgctgcaaagacagtccccatgcct
ttgcactgtctgcatatgcagctgacaaccgattatcattttcgtgatggtgtggtcaag
gaatattttcgtgatgctgctttgaaggaggaagaagataaggcaaagcgtgaggatcgg
tctctataccactacgctatattttcagataacgtccttgcagcctcagtagttgttaga
tcaacggtgacacatgccaaggaaccagagaagcatgtattccacattgtcactgataga
cttaattttgcagctatgacaatgtggttcataagcaatcctcctctacctgctactgtc
catgtggaaaacattgacaacttcaagtggctcaattcgtcatactgttcagttctacga
caacttgagtcagctcggctcaaagagtactatttcaaagcacatgatccatcgtcactc
tctgatggaaatgaaaatctgaagtacaggaaccccaaatatctgtctatgcttaaccat
ctaaggttctacatgccagaaatacaccccaagcttgacaagatactgtttctcgatgac
gatgttgttgtgcagaaggacttgacaccgctatgggatgttgatcttaaagggatagta
aatggtgcagttgaaacctgcaaagaaagtttccatcgcttcaacacatacctcaatttc
tcacacccaaagatctcagagaactttgatccacatgcttgtgggtgggcttttgggatg
aacatgtttgacctgaaagagtggaagaagcaaaatatcactggaatataccattattgg
caagatctgaatgaggatcgtaagctgtggaagctggatacattgcctccaggactgatt
actttctacaacctgacatacccattgaatcgcacttggcatgtgttgggccttggctat
gatccatctgttgaccttgttgagattgagaatgcagcagtagttcattacaatgggaat
tacaagccctggctagaccttgccatttccaagtacaagccctactggtccaagtatgta
gatcttgacaactcacacattcaacgctgctacatgagtgagcaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344307
Entry
4344307           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 7
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4344307
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4344307
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4344307
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4344307
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4344307
NCBI-ProteinID: XP_015644968
UniProt: A0A0P0XAH1
LinkDB
Position
7:28908953..28914031
AA seq 625 aa
MKATLLPPPPPPAKRRRGPRVAVLALFLCSLLVPLAFLFDRSQSGYVTTDERRRQEVVLP
EFHHVEKADGDGTVNGLNQDAPKKTPKVNSGGLQKHKQTDRHTSRISTKPKVLPSPKVDP
SEAVKESTQGTREVSKVRKRLDKGTNTDEVENEKACQLEFGSYCLWSREHKVVMKDSIVK
RLKDQLFVARSYYPSIAKLEGQEELTVLMKQNIQDHERVLSVSTVDADLPSFINKKMEQM
EQTIARAKSCTVDCRNVDRKLRQILDMTEDEAHFHMKQSAFLYNLGAQTLPKSHHCLSMR
LTLEYFTSSSLGSNDSSARKFSAAHGRHYVILSKNILAASVVINSTVNSSKDPKKIIFHI
LTDAQNFYAMKYWFDKKSYREAAIHVVNYEDIIKEKLTKFNVRHLYLSEEFRVLVRSTEQ
PAGKTRMEYLSLFSHSHFFIPEIFKDLNKVVVLDDDVVVQRDLSFLWSLDMGDKVNGAIE
FCGLRLGQVRNLLGSTTVDTKSCAWMSGINVINLDKWRKHKVTENYLLLLKKFLTKDETS
LRAAAFPLSLLSFQHLIYPLDERLILSGLGYDYAIDEDVARSSAALHYNGNMKPWLELGI
PSYRRYWKRFLTRDDKFMDECNIIP
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaaggcgacgctgctgccgccgccgccgccgccggcgaagaggcggagggggccacgc
gtggccgtgctggcgctcttcctctgctcgctgctcgttcccctcgccttcctcttcgac
cgctctcaatccgggtacgtcacgacggatgagcggcgccgacaggaggttgttttgcct
gagttccatcacgtggagaaggcggatggtgacggtactgtcaatggactgaatcaggat
gcaccaaagaagacgcccaaagttaacagcggagggctgcagaagcataagcaaactgat
cgacacacctcccgtattagcactaaaccaaaagttcttccctcaccaaaagttgaccca
tcagaggctgtgaaggagtcaactcaaggcacaagagaggttagcaaagttagaaagaga
ctagacaaaggcacaaacacagatgaagtggaaaatgagaaggcttgtcaacttgaattt
ggtagctactgtctctggtccagagaacacaaagtagtcatgaaggactccattgtgaaa
aggctaaaagaccaactatttgtggcacgctcatattatccaagcattgcgaagcttgaa
ggacaggaggaacttactgtgctaatgaagcaaaacatacaagaccatgagagggttctt
agtgtatcgactgttgatgctgatctaccgtcctttatcaacaagaagatggagcagatg
gagcaaacaatagctagagcaaaatcttgcactgtagattgtcgaaatgttgacaggaaa
cttcgtcagatacttgacatgactgaggatgaagctcactttcatatgaagcagagtgca
ttcctctacaaccttggtgctcagacgttgcctaagagtcatcactgtctatctatgagg
ttgacattagagtatttcacatcctcttcactgggttcaaatgattcttctgctcgcaaa
tttagtgctgcacatggtaggcactatgtcatactatctaagaacatccttgctgcttcg
gttgttatcaactcaacagtgaacagttcaaaggacccaaaaaaaatcatttttcatatc
ttaactgatgctcaaaatttctatgccatgaaatactggtttgacaaaaagtcatacaga
gaggcagctatccatgtcgtgaactatgaggatattatcaaggagaagttaacaaagttt
aatgtgcggcacctgtatctgtccgaggagttccgtgttcttgttaggagtactgagcaa
cctgctgggaagacaagaatggaatacctatcattatttagtcactcacatttcttcatt
ccagaaatatttaaggatctaaataaggtggttgtgttggatgatgatgtggttgttcaa
cgtgatctttctttcttgtggtctcttgatatgggggacaaggtaaatggtgctatcgaa
ttttgtggtttaagactgggtcaagtgagaaatctcttgggtagtacaacagttgatacc
aagtcatgtgcatggatgtctggaataaatgttataaatttggataaatggaggaagcac
aaagttacagagaactacctgctgcttctgaaaaagttcttgacgaaggatgagacatct
ctgcgagcagcagcctttcctctaagtttgttatctttccaacacctcatttatcccctt
gatgagaggttgattctatctggacttggatatgattatgcaattgatgaagacgttgca
cggagttctgcagcattgcactacaatggcaatatgaaaccttggcttgaattaggtata
ccaagctacaggagatactggaagaggttcctaactcgagacgataaattcatggatgag
tgcaacataattccctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345284
Entry
4345284           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 4
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4345284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345284
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4345284
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4345284
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4345284
NCBI-ProteinID: XP_015651096
UniProt: A0A0P0XEP1
LinkDB
Position
8:14397890..14403058
AA seq 643 aa
MVRRRRRSVLLLLLALTVLSPLVLYTRRLSAALNPNQRRDLPGEIVNQGRGVKASKLNAL
PLETVGSLKEPVGIVFSEESRESASKSTEPDSQEFLLRKAGEHKNRVLSEATAADSARSE
DDDLIEQVTSKDGEDDGLATVSVDQQQITTASQQRSASEASSLENVPEQTSMENSLEGNK
DGALLDTRIRNIRDLLIKAKVYLGLGAIRANPQYLKDLRQRIREVQKVLGDASKDSDLPK
NANEKVKTLEQTLIKGKLMQDDCSVVVKKLRAMLHSAEEQLHAHKKQTVFLTQLAAKTLP
KGLHCLPLRLANEYFLLDPSHQQFPNKEKLDDPKLYHYALFSDNILAAAVVVNSTVLNAK
HPSHHVFHIVTDRLNYAPMRMWFLSNPPGKATIEVRNIEEFTWLNASYSPVLKQLESQSM
IDYYFRTHRANSDSNLKYRNPKYLSILNHLRFYLPEIYPNLHKIVFLDDDVVIKKDLTSL
WSIDMKGKVIGVVETCGESFHRFDRYLNFSNPVIVKNFDPHACGWAFGMNVFDLAEWRRQ
NITEIYHSWQKLNQDRLLWKLGTLPPGLITFWNKTLPLNRSWHVLGLGYNPHVSSRDIER
AAVIHYNGNMKPWLEIGLPKFRNYWSAYLDYDQPFLRECNINP
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggtgaggcggcggcggcggtccgtgctgctgctcctcctcgccctcacggtgctctcg
ccgctcgtgctctacacgcgccgtctctcggcggcgctgaaccccaaccagaggagggat
ttgcctggcgaaatcgtgaatcagggccgtggtgttaaggctagcaagctaaatgcactt
cctctggaaactgtgggttctttgaaagaacccgttggcatcgtcttctcggaggagtca
cgcgaatctgcaagcaaatcgaccgaacccgatagccaagaatttctattgaggaaggca
ggggagcacaagaaccgggtgctctctgaggccacggctgctgatagtgccagatcggaa
gacgatgacttgatcgagcaagtgacaagcaaggatggagaagatgatggcttggcgacg
gtgtcagttgatcagcagcagataaccacggcatcccaacagcgatctgcttctgaggca
agttcattggagaatgtgcctgaacagacatccatggaaaactctctggaaggaaacaaa
gatggtgctttgcttgatactagaatccgcaatatcagggatctgttaatcaaggcaaag
gtctaccttggtcttggagccattcgagcaaatccccagtacctcaaagacttgaggcag
cggattcgggaagttcaaaaggttcttggtgatgcatccaaggactccgatctacccaag
aatgccaatgagaaggtgaaaacacttgagcagacactgatcaagggaaaactgatgcag
gatgattgttctgttgttgtcaaaaagcttcgagctatgcttcactcagctgaggagcaa
ctgcatgcacacaagaagcaaactgttttcctaacacaacttgcagccaaaacccttccc
aagggtcttcactgcctccccttgaggctagctaatgaatattttttattggatcctagc
catcagcaattcccaaacaaggaaaaacttgatgaccccaaactatatcactatgcattg
ttctctgacaatatattggcagcagctgtagttgttaattcaacagtgttaaatgccaag
catccttctcatcatgtcttccacatagtaactgacagactaaactatgctccaatgaga
atgtggttcctctctaaccctcctgggaaagcaacgattgaagtacggaatattgaagag
ttcacatggctaaatgccagctacagcccagtgctgaaacagctcgaatcacaatcaatg
attgattactacttcaggacacatcgtgcaaactcagattcaaacttgaagtacagaaac
ccaaaatatctttctattctcaatcatttgcgattttatctacctgagatttacccaaat
ctccacaagattgtctttcttgatgatgatgtagtgataaagaaggacctaaccagcctc
tggtcaattgatatgaaggggaaagtaattggtgttgtagagacttgtggagagagcttc
catcgttttgatcgttaccttaatttctcaaatcctgtcattgtgaagaattttgacccc
catgcatgtggatgggcttttggaatgaatgtctttgatctggctgaatggaggcggcag
aacataactgaaatctatcactcctggcaaaagcttaatcaggacagattactatggaaa
cttggcactctgcctccaggtttgattacattctggaataagacgcttcccctcaatcgt
tcatggcatgtccttggtcttggttacaacccgcatgtgagcagcagagatattgaacgt
gccgcggtcatacattacaatggcaatatgaagccttggctggagattggtctgcccaaa
ttccgaaactactggtcggcatacctcgattatgaccagcccttcctgcgggagtgtaac
atcaatccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347389
Entry
4347389           CDS       T01015                                 
Name
(RefSeq) probable galacturonosyltransferase 4
  KO
K13648  alpha-1,4-galacturonosyltransferase [EC:2.4.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4347389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4347389
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.43  polygalacturonate 4-alpha-galacturonosyltransferase
     4347389
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Structural polysaccharide
   4347389
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 4347389
NCBI-ProteinID: XP_015611931
UniProt: B9G471 Q69QS2
LinkDB
Position
9:18441040..18445160
AA seq 707 aa
MVAVARGRRCRGVVLLLLLSSVLAPLVLYGGSPVSVSTLPDSTVASGVLDRDGEYNLVVA
ASDVSLTKDLTIERLGEHKNRVLSATEDWQVVEAASKNPAFEKSDASVSRKDPGSGDANV
VITEGNGAAQSGRDGVIWEVVSRDRGSDGFTQPWEINGGEERDGERVDRVKLGVSVEEQN
DGTGETGVNNIAGTHTSGNLNSSLEKERSTGRLSEQVTKAIPKESYTPTTNSNSALPTSV
SAGHSTTSPDATIRTIKDQLTRATTYLSLVASRGNHGFARELRARMRDIQRVLGDATSGG
QLPQNVLSKIRAMEQTLGKGKRILDSCSGALNRLRATLHSTEERLQSHKKETNYLAQVAA
KSLPKGLHCLPLRLTNEYYYTNSNNKKFPHIEKLEDPKLYHYALFSDNVLAAAVVVNSTI
IHAKKPADHVFHIVTDRLNYAAMKMWFLANPLGEAAIQVQNIEEFTWLNSTYSPVMKQLE
SQSMIDYYFKSGQARRDENPKFRNPKYLSMLNHLRFYLPEIFPKLSKVLFLDDDTVVQQD
LSAIWSIDLKGKVNGAVETCGETFHRFDKYLNFSNPLIASNFDPRACGWAYGMNVFDLSE
WRRQKITDVYHNWQRLNENRILWKLGTLPAGLVTFWNRTFPLHHSWHQLGLGYNPNINEK
DIRRASVIHYNGNLKPWLEIGLSRYRKYWSKYVDFDQVFLRDCNINP
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggtggcggtggcgcggggccggcgctgcaggggcgtggtgctgctgctcctcctctcg
tcggtgctcgcgcccctcgtcctctacggcggctcccccgtctccgtctccaccctcccg
gactccaccgtggcgagcggcgtgctggatcgggatggcgagtacaatctggtggtggct
gcctccgacgtctccctcaccaaagatttgacgattgagaggctaggcgagcacaagaac
cgggtgctatcagcaaccgaagattggcaagtggttgaggcggcgagtaagaatccggca
ttcgagaaatccgatgcaagtgtatcgaggaaggacccaggatcaggggatgccaatgtg
gtgattactgaagggaatggtgctgctcagtcgggacgggatggcgttatctgggaggtt
gtcagcagggacagaggttcagatgggtttactcaaccatgggagatcaacggaggtgag
gagcgggatggtgaaagggttgatagggtaaagttgggtgttagtgtggaagaacagaat
gatggaacaggtgaaacaggggtgaacaacattgctggaacgcacactagtggaaacctg
aattcatccctagaaaaggaaaggagcactggtagattgtctgaacaagttacaaaagct
attcccaaagagtcttacacaccaacaactaacagtaattctgctctcccaacaagtgtt
agtgctggtcattccactacttccccagacgctaccatccgcacaatcaaggaccagttg
acgagagcaacgacatatctgagccttgtagcttctagaggcaatcatggttttgcaagg
gagcttcgtgcacggatgagggatatccaaagagtcctaggtgatgcaaccagtggtggc
cagcttcctcagaatgtacttagcaaaataagagcaatggagcaaacattgggaaaggga
aagagaattcttgatagttgctcgggtgctctgaacaggctccgtgcaacccttcactca
acagaggagcgactccaatctcataaaaaggaaaccaactatctagcacaagtagcagca
aaatctttaccaaaaggacttcattgccttccgctgcggcttacaaatgagtactactac
accaactccaacaataaaaaattcccacatatagaaaagttggaagatccaaaactctat
cactatgcgttgttctcagataatgtgttggctgctgcagtggttgtaaactccactatt
attcatgctaagaaaccagcagatcatgtcttccacattgtcacggataggcttaactat
gctgcaatgaagatgtggttcttggctaatcccttgggtgaagcagccattcaggttcaa
aacattgaagagtttacatggctgaattctacctacagtccagttatgaagcagctagaa
tcacagtctatgattgattactacttcaagagtgggcaggccaggcgtgatgaaaatccc
aagttccggaaccccaagtacttgtcaatgctcaatcatctgaggttttatctccctgaa
atcttcccgaagcttagcaaggtgttattcctggatgatgacactgtagtacagcaggac
ttaagtgcgatttggtccattgatctaaaaggcaaggttaatggtgctgttgagacctgt
ggagagacctttcataggtttgataagtacctcaacttctcaaatcctcttattgccagc
aattttgacccgcgtgcctgcggttgggcgtatggcatgaatgtgttcgatctatctgag
tggagaagacaaaagattactgacgtctaccacaattggcaaagactgaacgaaaatagg
atattgtggaagctaggtactcttcctgctggtctcgtaacattttggaaccgtaccttc
cctcttcatcactcctggcatcagttgggacttgggtacaacccaaacatcaatgagaag
gatatccggagggcatctgtcatacactacaatggtaatctgaaaccctggcttgagatt
ggattgtccagatatcgcaaatactggtcaaaatacgtcgatttcgatcaagtcttccta
cgggactgcaatataaatccctga

DBGET integrated database retrieval system