KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329450
Entry
4329450           CDS       T01015                                 
Name
(RefSeq) acetolactate synthase 1, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00650  Butanoate metabolism
osa00660  C5-Branched dibasic acid metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4329450
   00660 C5-Branched dibasic acid metabolism
    4329450
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4329450
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4329450
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     4329450
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 4329450
NCBI-ProteinID: XP_015626459
UniProt: Q6K2E8 Q0E0Z3
LinkDB
Position
2:18236030..18238352
AA seq 644 aa
MATTAAAAAAALSAAATAKTGRKNHQRHHVLPARGRVGAAAVRCSAVSPVTPPSPAPPAT
PLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEIHQALTRSPVITNHLFRHEQG
EAFAASGYARASGRVGVCVATSGPGATNLVSALADALLDSVPMVAITGQVPRRMIGTDAF
QETPIVEVTRSITKHNYLVLDVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPV
WDTSMNLPGYIARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRWFVELTGI
PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDDRVTGKIEAFA
SRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALLQQSTTKTSSDFSAWHNELDQ
QKREFPLGYKTFGEEIPPQYAIQVLDELTKGEAIIATGVGQHQMWAAQYYTYKRPRQWLS
SAGLGAMGFGLPAAAGASVANPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQ
HLGMVVQWEDRFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK
KMLETPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTVY
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggctacgaccgccgcggccgcggccgccgccctgtccgccgccgcgacggccaagacc
ggccgtaagaaccaccagcgacaccacgtccttcccgctcgaggccgggtgggggcggcg
gcggtcaggtgctcggcggtgtccccggtcaccccgccgtccccggcgccgccggccacg
ccgctccggccgtgggggccggccgagccccgcaagggcgcggacatcctcgtggaggcg
ctggagcggtgcggcgtcagcgacgtgttcgcctacccgggcggcgcgtccatggagatc
caccaggcgctgacgcgctccccggtcatcaccaaccacctcttccgccacgagcagggc
gaggcgttcgcggcgtccgggtacgcgcgcgcgtccggccgcgtcggggtctgcgtcgcc
acctccggccccggggcaaccaacctcgtgtccgcgctcgccgacgcgctgctcgactcc
gtcccgatggtcgccatcacgggccaggtcccccgccgcatgatcggcaccgacgccttc
caggagacgcccatagtcgaggtcacccgctccatcaccaagcacaattaccttgtcctt
gatgtggaggacatcccccgcgtcatacaggaagccttcttcctcgcgtcctcgggccgt
cctggcccggtgctggtcgacatccccaaggacatccagcagcagatggccgtgccggtc
tgggacacctcgatgaatctaccagggtacatcgcacgcctgcccaagccacccgcgaca
gaattgcttgagcaggtcttgcgtctggttggcgagtcacggcgcccgattctctatgtc
ggtggtggctgctctgcatctggtgacgaattgcgctggtttgttgagctgactggtatc
ccagttacaaccactctgatgggcctcggcaatttccccagtgacgacccgttgtccctg
cgcatgcttgggatgcatggcacggtgtacgcaaattatgccgtggataaggctgacctg
ttgcttgcgtttggtgtgcggtttgatgatcgtgtgacagggaaaattgaggcttttgca
agcagggccaagattgtgcacattgacattgatccagcagagattggaaagaacaagcaa
ccacatgtgtcaatttgcgcagatgttaagcttgctttacagggcttgaatgctctgcta
caacagagcacaacaaagacaagttctgattttagtgcatggcacaatgagttggaccag
cagaagagggagtttcctctggggtacaaaacttttggtgaagagatcccaccgcaatat
gccattcaggtgctggatgagctgacgaaaggtgaggcaatcatcgctactggtgttggg
cagcaccagatgtgggcggcacaatattacacctacaagcggccacggcagtggctgtct
tcggctggtctgggcgcaatgggatttgggctgcctgctgcagctggtgcttctgtggct
aacccaggtgtcacagttgttgatattgatggggatggtagcttcctcatgaacattcag
gagctggcattgatccgcattgagaacctccctgtgaaggtgatggtgttgaacaaccaa
catttgggtatggtggtgcaatgggaggataggttttacaaggcgaatagggcgcataca
tacttgggcaacccggaatgtgagagcgagatatatccagattttgtgactattgctaag
gggttcaatattcctgcagtccgtgtaacaaagaagagtgaagtccgtgccgccatcaag
aagatgctcgagactccagggccatacttgttggatatcatcgtcccgcaccaggagcat
gtgctgcctatgatcccaagtgggggcgcattcaaggacatgatcctggatggtgatggc
aggactgtgtattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329938
Entry
4329938           CDS       T01015                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic isoform X1
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00650  Butanoate metabolism
osa00660  C5-Branched dibasic acid metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4329938
   00660 C5-Branched dibasic acid metabolism
    4329938
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4329938
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4329938
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     4329938
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 DUF4423
Other DBs
NCBI-GeneID: 4329938
NCBI-ProteinID: XP_015627718
LinkDB
Position
2:23885337..23890675
AA seq 484 aa
MSVASPHHLRPSPLAPACRAGGVPARAAAAHRPWCPRVRRAVAAASSGGGGGEAVTAVSA
AAVGAPASAARDTECRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAM
FTIVVSGTDRVLNQVIEQLNKLVNVLNVEDLSKEPQVERELMLIKINVEPDQRPEVMVLV
DIFRAKVVDISENTLTIEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRREKIGATARF
WGFSAASYPDLIEALPKNSLLTSVNKTVNGSFDQPSNAGGDVYPVEPYEGSSMNQVLDAH
WGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKSGLSRITT
VAPGTDESIEKLVQQLNKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRDILDIAEIF
RAKSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGY
SFPL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtccgtcgcctccccgcaccatctccgcccctcgccgctggcgccggcatgccgtgct
ggcggcgtccccgcgcgcgccgcggcggcgcaccggccatggtgcccgcgcgtccgccgg
gccgtcgccgcggcctcctccggcggcggcggcggcgaggcggtgacggcggtgagcgcg
gcggcggtgggggcgcccgcgagcgccgcgagggacacggaatgcagggtgcggcgccac
acgatctctgtgttcgtcggcgacgagagcgggatgataaaccggatcgccggggtgttc
gccaggagagggtacaacatcgagtcgctcgccgtggggctcaacaaggacaaggccatg
ttcaccattgtcgtctccggcacggacagggtgctcaaccaagtcatcgagcagctcaac
aagcttgtcaacgtcttgaatgtggaagatctatctaaggagccacaggttgaaagagag
ctgatgcttataaaaattaatgttgaaccagatcagcgtcctgaggtcatggttttagtt
gatattttccgagcgaaagttgttgatatttcggagaacacccttaccatcgaggtaact
ggagatcctggcaaaattgttgctgtgcaaaggaacctcagcaaatttgggataaaagaa
atttgtagaacgggaaaaattgctttgagacgtgaaaaaattggagcaactgcccgcttc
tggggattttctgctgcttcttacccagatctcatagaggcattgcccaaaaattctctt
cttacttctgtaaataagacagtcaatggaagttttgatcaaccatccaatgctgggggc
gatgtctatcctgtggaaccttatgagggttcatccatgaaccaagtacttgatgctcac
tggggcgtccttgatgatgaagattcaagtggacttcgatcacatactctatccatcctt
gtcaatgattgccctggtgttctcaacattgttacaggggtctttgctcgcagaggctac
aatatacagagtcttgctgtaggcccagctgaaaagtcaggcctttcgcgtattacaaca
gttgctcctggaacagatgaatccattgagaagttagttcagcagcttaacaaacttgtt
gatgtgcatgaggttcaagatataactcacttgccttttgctgaaagagaacttatgctt
atcaaggtttctgtgaacactgctgctcggagagacatactagatattgctgaaatcttc
cgggcaaaatctgttgatgtttctgatcacactgttacgttacagcttactggggatctc
gacaagatggttgcattacaaaggctgttggagccttatggcatctgtgaggtcgccaga
acagggcgagtggcgctggtccgcgaatccggtgtcgattccaagtaccttcgtggctac
tcctttccgttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335672
Entry
4335672           CDS       T01015                                 
Name
(RefSeq) probable acetolactate synthase 2, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00650  Butanoate metabolism
osa00660  C5-Branched dibasic acid metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4335672
   00660 C5-Branched dibasic acid metabolism
    4335672
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4335672
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4335672
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     4335672
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Other DBs
NCBI-GeneID: 4335672
NCBI-ProteinID: XP_015634624
UniProt: Q7XKQ8
LinkDB
Position
4:19169075..19171400
AA seq 663 aa
MAAAAAAASLSVSDAAAKLPKPGGQVQRRRDRDRPRVDAAACTRDSRRPTRERCSTTVSL
AATATATTATPVRAPVRTRAPMGQRKGADIVVEALERCGVRDVFEYPGGASMEIHQALTR
SPVIRNHLLRHEQGEAFAASGYARSSGRPGVCVATSGPGATNLVSALADAHLDSVPLVAI
TGQAPRRMIGTDAFQETPIVEFTRSITKHNYLILDVDDIPRVINEAFFLASTGRPGPVLV
DIPKDIQQQMAVPSWDAPMRLPGYISRLPKPPAANLLDEVIRLVGDAERPVLYVGGGCSA
SGYELRRFVELTGIPVTTTLMGIGNFPSDDPLSLRMLGMHGTVYANYAVDNADLLLALGV
RFDDRVTGKVEAFASRAKIVHVDIDPSELGKNKQPHVSICADVKLALQGMNAMLEEQSAA
AARKNLDFSAWRSELEKKKVEFPLGYRTFGEEIPPQYAIQVLDEVTNGEAIVATGVGQHQ
MWATQHYTYRRPRQWLSSAGLGAMGFGLPAAAGAAVANPGATVVDIDGDGSLLMNIQELA
MVRVEDLPVKVMVLNNQHLGMVVQWEDRFYDANRAHTYLGNPAANGGGEVYPDFVTIAGG
FGIPAARVTRKGEVRAAVEEMMAAPGPYLLDVVVPHQEHVLPMIPSNGAFKDIIVDGDGR
SSY
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggctgccgccgccgccgccgcctcactctccgtctccgacgccgccgctaagctgccc
aaaccgggagggcaagtgcaacggcgacgcgacagggatcgtccacgcgtggatgctgcc
gcctgcacccgcgacagccgccgtcccacgcgcgagaggtgctcgacgacggtgtccctc
gccgcgaccgcgaccgcgacaacggccacgcccgtgcgcgcgccggtccggacgcgggcg
cccatggggcagcggaagggcgcggacatcgtcgtcgaggcgctggagcggtgcggcgtc
cgcgacgtgttcgagtacccgggcggcgcgtcaatggagatccaccaggcgctgacgcgg
tcgccggtgatccgcaaccacctgctccgccacgagcagggggaggccttcgcggcgtcc
gggtacgcgcgctcgtcggggcggccgggcgtctgcgtcgccacctccggcccgggcgcc
accaacctcgtgtccgcgctcgccgacgcccacctcgactccgtcccgctcgtcgccatc
acggggcaggccccgcgccgcatgatcggcaccgacgcgttccaggagacgcccatcgtc
gagttcacccgctccatcaccaagcacaactacctaatcctcgacgtcgacgacatcccc
cgcgtcatcaacgaggccttcttcctcgcgtccacgggtcgccccggcccggtgctcgtc
gacatccccaaggacatccagcagcagatggccgtgccgtcctgggacgcgccgatgcgc
ctcccggggtacatctcccggctgccgaagccgccggccgccaacctgctcgacgaagtc
atccgcctcgtcggcgacgccgagaggcccgtcctctacgtcggcggcgggtgctccgcg
tcgggctacgagctgcggcgcttcgtggagctgacgggcatcccggtgacgaccaccctc
atgggcatcgggaacttccccagcgacgacccgctctcgctgcggatgctcgggatgcat
ggcactgtgtacgccaactacgccgtcgacaacgccgacctcctcctcgcgctcggcgtg
cgcttcgacgaccgcgtcaccggcaaagtcgaggcgttcgcgagcagggccaagatcgtg
cacgtcgacatcgacccgtcggagctcgggaagaacaagcagccgcacgtctccatctgc
gccgacgtcaagctcgccctgcagggcatgaacgcgatgctggaagaacagagcgccgcc
gccgcgcgcaagaacctcgatttcagcgcgtggcgctcggagctggagaagaagaaggtc
gagttcccactgggctacagaacgttcggcgaggagatcccgccgcagtacgccatccag
gtgctcgacgaggtcaccaacggggaggccatcgtcgccacgggcgtcgggcagcaccag
atgtgggcgacgcagcactacacctacaggaggcccaggcagtggctctcgtccgccggg
ctgggcgccatgggcttcggcctgcctgccgccgccggcgccgcggtggccaacccgggc
gccaccgtggtcgacatcgacggcgacggcagcctcctgatgaacatccaggagctcgcc
atggtccgcgtcgaggacctgccggtgaaggtgatggtgctgaacaaccagcacctgggc
atggtggtgcagtgggaggacaggttctacgacgccaacagggcgcacacctacctcggc
aacccggcggcgaacggcggcggcgaggtgtacccggacttcgtgacgatcgccggaggc
ttcggcatcccggcggcccgcgtgacgaggaagggcgaggtccgcgccgccgtcgaggag
atgatggcggcgccggggccgtacctgctggacgtcgtcgtgcctcaccaggagcacgtg
ctgccgatgatccccagcaatggcgctttcaaggacattatcgtcgacggtgatggccgg
agttcgtattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350218
Entry
4350218           CDS       T01015                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00650  Butanoate metabolism
osa00660  C5-Branched dibasic acid metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4350218
   00660 C5-Branched dibasic acid metabolism
    4350218
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4350218
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4350218
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     4350218
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NikR_C
Other DBs
NCBI-GeneID: 4350218
NCBI-ProteinID: XP_015615160
UniProt: Q2R7U1 Q53L28
LinkDB
Position
11:complement(8417503..8422715)
AA seq 476 aa
MATATAASRLAVAGAEPARARRHRPTTVAVCGGARPRSRPAAVVAAAGAAAPSPATGGVA
PVPPSPRGSIIKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
GTEKILKQVVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAK
VVDLSDHTLTIEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREKMGESAPFWRFSAA
SYPDLEVAMPSKSHVNTAMKTANQNSEESSQGDVYPVESYENFTTNQILDAHWGVMADGD
PTGLCSHSLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDES
IAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIKIAVNTTARRAILDIADIFRAKTVDVS
DHTVTLQLTGDLDKMVALQRMLEPYGICEVARTGRVALRRESGVDSKYLRGFSLPL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctaccgccaccgccgcctcccgcctcgcggtggccggcgctgaacccgctcgcgcc
cggcgccaccgcccgacgacggtggcagtctgcgggggcgcgaggccgaggtcgcgcccc
gcggccgtcgttgccgccgccggcgccgccgctccctctccggccaccggcggcgtcgcg
ccggttccgccaagccccaggggctcgattataaagcgtcatacactatcagtttttgtt
ggagatgaaagtgggatgattaatcgaattgctggagtttttgctagaagaggatacaac
attgagtcattggcagttgggctgaacaaggacaaggcattatttacaatagtagtatct
ggaactgagaaaatactgaaacaggttgtagagcaactaaacaaacttgttaatgttata
caggttgacgatctgtcgaaggaaccacaagttgaaagagagctaatgcttataaaacta
aatgttgagccagataagcgaccggaggtgatgggtttggttgacatcttcagagcaaag
gtggttgacctttctgaccacacactaactattgaggtaactggagatcctggaaaaatt
gttgctgtacagaggaacctaagcaaatttggaatcaaagaaattgccagaactggcaag
atagctttgcggcgtgagaaaatgggagaaagtgctcctttttggcggttctctgcagct
tcctatcctgatcttgaagtggcaatgccatcaaaatctcatgtcaacactgcgatgaaa
acagctaaccagaattctgaagaatcttcacaaggtgatgtctatccagtggagtcatat
gaaaacttcacaacaaatcaaattcttgatgctcattggggtgtcatggctgacggtgat
ccaacagggctttgttcacattctttgtccattttggtgaatgatttccctggagttctc
aatgttgtaacaggtgttttctcccgaagaggctacaatattcagagtctggctgttggc
ccagctgaaaaagaaggcacttctcggatcactactgttgtccctggaactgatgagtct
attgccaagctagtacaccaactgtataagctcattgatgtttatgaggtccaggatctt
actcatttaccatttgctgctagagagttaatgatcataaagattgctgtaaacaccaca
gcccgcagggctatcctagatattgctgatattttccgggccaaaactgtggatgtatca
gatcacaccgtaactcttcagcttactggagaccttgataaaatggtcgcattacaaagg
atgctcgagccctatggcatttgtgaggttgcacgaactggcagggttgcgttgcgccgt
gagtcaggagtcgattccaaatacctccgtgggttttcccttcctctgtag

DBGET integrated database retrieval system