KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329455
Entry
4329455           CDS       T01015                                 
Name
(RefSeq) SART-1 family protein DOT2 isoform X1
  KO
K11984  U4/U6.U5 tri-snRNP-associated protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329455
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329455
   04121 Ubiquitin system [BR:osa04121]
    4329455
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    4329455
 Complex C
   U4/U6.U5 tri-SnRNP specific factors
    4329455
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4329455
SSDB
Motif
Pfam: SART-1
Other DBs
NCBI-GeneID: 4329455
NCBI-ProteinID: XP_015626544
UniProt: A3A7A3
LinkDB
Position
2:complement(18311492..18317615)
AA seq 804 aa
MSHVRSASDRHRDKEKEKERRETHRREEKDHHGSGRRDRDRDRESYREKDKDDRREKEKE
KEKERDSERGRGRDRDRGKDRDRGEAERDKERERKDRDKEKSRGRDKSKEEREDKDYRDK
SRGKDRGDDGGDLSKGEEGDQKKRVEAAEEAEKPSTTELRERIARSKEERLNDTKQGGIL
DDNGGDGEILSWVGKSRKLDEKRQAEKEKALHRARALEEQDNILAENDEDDDEEQQEDNR
VGEHLSGVKVLHGLDKVLEGGAVVMTLKDQSILADGDINQEADMLENIEIGEQKQRNEAY
KAAKKKGTYDDKFNDDPLSKKSILSQYDDPMEDEGVTLDEGGRFSGEAEKKLEELRKRIE
GGFVQKKTEDLTSAAKMSSDYYTPDEMLQFKKPKKKKSLRKKEKLDLDALESEAIAAGLG
TGDLGSRKDARRQAAREEEQKADAEKRNYAYQAAIAKAEEASKALRPEKNISGKHAESEE
LVFGEDYEDLQKSLEQARKLALRKQEETAASGPLAVAELATARIGQKDADAAEGDAQQNK
VVITEMEEFVWGLQLNEETRKPEAEDVFMDEDDDMIMSDTVAKDDMSGLAVVKEETSVEV
PVKNEEEEELKPDEIVHEAAVGKGLAGALKFLKERGTLNEGTDWGGRTTDKKKSKLAGIE
DGPKDIRIERIDEFGRVMTPKEAFRDLSHKFHGKAPGKMKQERRQKKYRDELKTKRMISS
DTPLMSAEKMREAQALSKTPYLVLSGNAKSGQTSDASGFATVEKEHPGSLTPMLGAKKVE
HFLGIKRSAQGGGLPPPPPKKPKN
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtcgcacgtgaggtccgcctccgataggcaccgggacaaggagaaggagaaggagagg
agggagacgcaccggagggaggagaaggatcaccacggcagcgggaggagggacagggac
agagacagggagagttatagagagaaggataaagatgacaggagggagaaggagaaggag
aaggagaaggagagggattccgagcgtggccgtggccgtgaccgtgatcgaggcaaggac
cgggataggggtgaggcagagcgggacaaggagagggagcggaaggacagggacaaggag
aagagccgcgggagggacaagagcaaggaggagagggaggataaggattaccgggacaag
tcgagaggcaaggacaggggagacgacggtggagatttgtcaaagggtgaagagggggat
cagaagaagagagttgaggccgcagaggaggccgagaaaccgtccacgactgagctcagg
gagcgcattgctaggtcaaaggaggaaagactgaatgatacaaagcaaggaggaatactg
gatgataatggtggtgatggtgagatattatcgtgggtgggcaagagtcgtaaacttgat
gaaaaaaggcaagctgaaaaagagaaagcattacatcgtgctcgagcattggaggaacag
gataacattttagctgaaaatgatgaggatgatgacgaggagcaacaggaggataaccga
gtgggagaacacttatctggtgtgaaggttcttcacggacttgataaagttttggaaggt
ggcgcagttgtcatgaccctaaaagatcagagcatcctggctgatggggatatcaatcaa
gaggctgatatgcttgagaacattgagattggtgagcagaagcaaaggaacgaagcttac
aaggccgcgaagaagaaaggaacatatgatgacaagttcaatgatgatcccttgtcaaag
aaatctatactctcacaatatgatgacccaatggaagatgagggagtgacacttgatgaa
ggtggacgcttcagtggtgaagctgaaaagaaactggaagagctccgcaaaagaattgaa
ggtggttttgtgcagaaaaagacagaagatcttacttccgcagcaaagatgtcatcagac
tattatactccagatgaaatgctccagtttaagaaaccaaagaaaaagaaatcccttagg
aagaaagaaaagcttgatctggatgcacttgagtctgaagctattgctgctggactgggg
acaggtgatcttgggtccagaaaagatgcaagacgacaggctgctagggaggaagagcaa
aaggctgatgctgaaaagagaaactatgcgtatcaagcagccattgcaaaggctgaagag
gcatcaaaagcattgcgcccggagaaaaatatttctggtaaacacgctgaatctgaagaa
ctagtttttggtgaagattacgaagatttgcagaaatctctggagcaagcaaggaaatta
gctctaaggaaacaggaagagactgctgcatctggtcctctggctgtagcagaactggct
actgcaagaataggtcaaaaagatgcagatgctgccgaaggagatgcacaacaaaataag
gttgttatcacagagatggaagagtttgtgtggggcctacagttgaatgaagagactcgc
aaaccagaagcagaagatgtttttatggatgaagatgatgacatgatcatgtcagacact
gtggcaaaagatgacatgagtgggctggccgtggtcaaagaggaaactagcgttgaagtc
ccagtaaagaatgaagaggaagaagagctaaaaccagatgagattgtacatgaagctgca
gttggcaagggtttggctggtgctttgaagtttctgaaggaacgaggaaccctcaatgag
ggcacagattggggaggcagaaccacagataagaagaaaagcaagcttgctggtattgag
gatggaccaaaagatattcgcatagaaagaattgatgaatttggtcgagtgatgacaccg
aaggaggcatttcgggatctttcacacaaattccatggcaaggcacctggtaaaatgaag
caggaacggcgccaaaaaaagtatcgggatgagttgaaaaccaagcgaatgatatcttct
gacacaccattaatgtctgcggagaagatgagagaggctcaagctctcagcaaaacacca
taccttgttttaagtggcaatgcaaaatcaggtcaaacgagcgatgccagtggctttgct
acagtggagaaagagcaccctgggagtctgacgcccatgcttggggccaaaaaggtcgag
cactttctgggcatcaaacgaagcgcccagggtggaggattgcctccaccacctccaaag
aagccaaagaactga

DBGET integrated database retrieval system