KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329458
Entry
4329458           CDS       T01015                                 
Name
(RefSeq) DNA polymerase epsilon catalytic subunit A isoform X1
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4329458
   03410 Base excision repair
    4329458
   03420 Nucleotide excision repair
    4329458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4329458
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329458
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4329458
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    4329458
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      4329458
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2
Other DBs
NCBI-GeneID: 4329458
NCBI-ProteinID: XP_015623163
LinkDB
Position
2:18348704..18370523
AA seq 2218 aa
MGGGGGGDGRRRRPSAGGGGGGGGRGGGWRSGSSAAKDQRLRLGAEELLESRLGFAPYTD
SERRLGWLLTFSPSSWEDEDTGKIYSCVDLYFVSQDGSTFKVKYKFPPYFYAATKDKMEL
EVEAYLRRRYEGDIADIEIIEKEDLDLKNHLSGLKRKYLKIQFDTVQQLMRVRSDLLHVV
EKNEEELNAAEAFESIYGVKRVERPQDYINCIIDLREYDVPYHVRFAIDNDVRCGQWYDV
SVSSSDVLLHRREDLLQRAEVHVCAFDIETTKLPLKFPDAEYDTVMMISYMIDGQGYLII
NRECVGEDIEDLEYTPKPEFEGHFKVKNVANELDLLKAWFSHMQEVKPGIYVTYNGDFFD
WPFLEKRAAHHGIKMNEEIGFQCDNNQGECRAKFSCHLDCFAWVKRDSYLPQGSHGLKAV
TKAKLGYDPLEVNPEDMVRFAMEQPQTMASYSVSDAVATYYLYMTYVHPFIFSLATIIPM
SPDEVLRKGSGTLCEMLLMVQAFKANIICPNKHQADLEKFYNNRLLESETYIGGHVECLE
TGVFRSDLPTKFQLEPSACEQLIANLDRDLQYAISVEGKLDIDSVTNYDEVKDAIKQKLV
SLRDHPIREECPLIYHLDVAAMYPNIILTNRLQPPSIVTDVDCTACDFNRPGKNCLRTLE
WVWRGETYMAKKSDYHHIKRQIESEMIQAGGVTPSKPFLDLSKPEHLLKLKDRLKKYCQK
AYKRVVDKPITEVRNAGICMRENSFYVDTVRSFRDRRYEYKGLNKSWKGKLAEAKANGNS
IKIQEAQDMVVLYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGAKIIQNARL
LVDKIGKPLELDTDGIWCVLPGSFPENFTFKTNAGKKLTISYPCVMLNVDVARNNTNDQY
QTLNDPVNKLYTTHSECSIEFEVDGPYKAMILPASKEEGVLLKKRYAVFNEDGTLAELKG
FEIKRRGELKLIKVFQAEVFDRFLHGSTLEECYTAVASVANRWLDLLDNQGIDISDNELL
DFISESSTMSKSLVDYGEQKSCAVTTAKRLAEFLGDSMVKDKGLHCQYIVAREPQGTPVS
ERAIPVAIFETDAEIAKFYLRKWCKISSEASIRSIVDWSYYKQRLSSAIQKIITIPAAMQ
KISNPVPRVLHPDWLHKKVREKDDRFRQRKLRDMFNPLEKDRGVQNLDGTGDMEDLLTLD
GGMRKSHVPNGFGKENKPNDAPSTEAGSKHSKNKQKSITRSNEPLAVHIQNDAADEQVDR
STDYQGWLDAKKRKWKYVREQKKRQRLGAAVTSDGPTNDLFSARNVGQLHGNARNRSTFF
QKQELALFRSHWQIIQLASSTLPGHFFAWVVAEGIMFKIPINVPRVFYLNSKAPVTEEFP
GRRVKKILPHGRPCFNLIEVVTSEEQFRVEGKKLAAHLAEPDVEGIYETKILPELNAILQ
IGCVCKVDKSAKRRSIQDGWDLAELQMKTTAECSYLEQTVSFFYLYHSLSEGRGVYVMYF
PTSFRIHAVVVNPFRNKELSPSFLEKQYRDACQALGSLHENITFLVDYHTSIDAGSKHVQ
RMLLEYRQQHPGPVIGVIECPKLQALKSAVRALDDFPCVTIPCNARDNNYQALGWQATAG
RTSMQRCAASTQWFNERISLARYAHVPLGNFELDWLLFTADVFFSRALRDQQQVLWISDD
GIPDLGGTYEGDTCFADEVIQPALTYPGAYRRVAVELKIHHLAVNSLLKSSQVDEMEGGP
IGSFANDMPAGPNGTETEFDDATLCLPAFQVLKQLIQRCISDAVSSGNVFADAILQHLYR
WLCSPRSKLHDPALHHLLHNVMKKVFALMLAEFRKLGANVIFANFSKIIIDTGKVDLLSA
RAYCDSLLKTLQTRDIFEWVELEPLHYWHSLLFMDQYNYGGIQAKMQNATSEGSSDGDND
IDIVSSWNIAEYLPKATQDHFVLIVSEFLYVPWKYMKEQVALRSTTRDETSCTPSITIMA
AENLEVQVIGYLRDQISNYFADKLLRIVSDILHHFKGKGKSESVELTNREPDPHTHKGDA
ALEFIKHICAVLALDQNVQHDILRMRKNLLKLVRVKEFAPEAQFQDPCASFTLPNVICSY
CNDCRDLDLCRDSTLQGQEWRCAVPQCGQPYHREQMENALLQVVRQRERLYHLQDLVCLR
CRQVKAAHLSEQCSCGGAFRCKEESSQFLSKMRVFLNVAVSQKFELLQDVVQWILEVR
NT seq 6657 nt   +upstreamnt  +downstreamnt
atgggcggcggcggtggcggcgatggtcggcggcggaggccgtcggccggaggaggagga
gggggagggggaaggggaggcggttggaggtctgggtcgtcggcggcgaaggaccagcgg
ctgcggctcggagcggaggagctcctggagagcaggcttggctttgcgccctacaccgac
agcgagcgccggctcggatggctcctgaccttctccccgtcatcatgggaggatgaggac
actgggaagatatacagctgtgttgacctatacttcgtgtcccaggacggttctacattt
aaagtgaaatacaaatttcccccttacttttatgctgcgactaaggataagatggagtta
gaagtcgaggcatatctcaggcgacgttatgaaggcgacattgctgacatagaaattatt
gagaaagaagatcttgatctaaaaaaccacctttctggtttgaagaggaaatatttgaag
atccagtttgataccgtacagcaattaatgcgtgtgagaagtgacctattgcatgttgtt
gaaaagaatgaagaagaactaaatgctgcagaggcatttgaatcaatttatggtgtaaaa
agggtagaaaggccacaagattacataaattgcatcattgatttgcgtgaatatgatgtt
ccatatcatgttcgttttgctatcgataatgacgtgaggtgtggacagtggtacgatgtt
agcgtatctagctctgatgttttgcttcacagaagggaagatctactacagcgtgcagaa
gttcatgtatgtgcatttgatattgaaaccacgaagctgcctctgaagtttccagatgct
gagtatgacactgtaatgatgatctcttacatgattgatgggcaaggatacctgataatc
aaccgagagtgtgtaggggaagatattgaagatttggagtatacacctaaaccagaattt
gaggggcattttaaagttaagaatgtcgcaaatgagttggatctactcaaagcttggttt
tctcacatgcaagaggttaagcctggtatttatgttacatacaacggcgacttttttgac
tggccatttttggagaagagagctgctcatcatgggattaaaatgaatgaggagattgga
ttccaatgtgataataatcaaggcgaatgccgagctaaattttcttgccatcttgactgt
tttgcttgggtgaagcgagacagttaccttccacaaggaagtcatggtctaaaggctgtt
acaaaagctaagttaggctatgatcctctggaggttaatccagaagatatggttcggttt
gcaatggagcagcctcagacaatggcttcttactctgtatcagatgctgttgcaacatac
tatctatacatgacttacgtccatccatttatcttttcccttgcaaccattatacctatg
tcacctgatgaggttttacggaaaggaagtgggacattgtgtgaaatgctgctaatggtc
caggcattcaaggctaatattatttgtcctaacaagcaccaagctgatctagagaagttc
tacaataaccgtctattggaaagcgaaacttatattggtggtcatgttgagtgtcttgaa
actggtgtatttagatctgatcttcctacgaagttccaacttgaaccgtcagcatgtgag
caactgattgcaaatcttgatcgtgatctgcaatatgccatttccgtagaaggaaaatta
gatattgattctgtcacaaactacgatgaagtcaaggatgccattaaacagaagctagtt
tctttgcgagatcaccctattcgtgaagaatgtccacttatatatcatctggatgttgct
gcgatgtatccaaatatcattttgacaaataggctccagccaccatccatagttaccgat
gtggactgcacagcatgtgatttcaatcgtcctggaaagaattgccttcggacgcttgaa
tgggtatggcgaggagagacctacatggcaaaaaagagtgactatcatcatataaagagg
caaattgagtcagagatgattcaagctggtggggtgacaccttcaaagccttttcttgac
ctctcaaaaccagagcatttactaaaactgaaggatcgtttgaagaagtactgccaaaag
gcatataaaagagtagttgacaaaccaattacagaagtgaggaacgctggaatatgcatg
cgtgaaaattccttctatgtagacacagtacgaagctttcgtgatagaaggtatgagtac
aaaggtcttaacaaatcatggaaaggaaaactggcagaagcaaaagccaatggaaattct
atcaaaattcaggaagcacaggacatggttgtgctctatgattcgttgcaacttgcccac
aagtgtatattgaattcgttttatggatatgttatgcgcaagggtgcaagatggtattct
atggaaatggctggtgttgttacatatactggtgcaaagattatccaaaatgctcgtcta
cttgtagacaaaattggaaagccactggaactagatactgatggcatttggtgtgttctt
cctggttcttttccagagaactttaccttcaagacaaatgctgggaagaagctcacgata
tcctatccctgtgtgatgcttaatgttgatgttgcgagaaacaacactaatgatcaatat
caaacattgaatgacccagtaaataagctatatacaacacacagtgaatgttccattgaa
tttgaggtagatggaccttacaaggctatgattctacctgcctctaaagaggaaggggtt
cttctaaagaaaaggtatgcggtctttaatgaagatggtaccttggcagaacttaaaggt
tttgaaatcaagcgtagaggtgagctgaagctcatcaaagtttttcaggcagaggtattt
gacagatttcttcatggttcaactttagaggaatgctatacagctgttgcttctgttgct
aatcgttggttagacctactggataaccaaggaattgatatttccgacaatgagttgctt
gatttcatatctgagtctagcacaatgagtaaatccctagttgactatggagaacaaaaa
tcatgtgctgtaacaacagcaaaaagactagctgaattcctcggggattcaatggtaaaa
gacaaagggctgcattgccaatacatagttgcccgggagccacagggcactccagtgagt
gagcgtgctattccagtagctatctttgagacggatgctgaaattgcaaagttttattta
agaaaatggtgtaaaatctcctctgaagcgagcatccgatctattgttgactggtcttac
tataagcaacgcctaagctctgctattcagaagattataacgattcctgcagcaatgcaa
aagatttcgaatcctgttcctcgagttcttcatcctgattggttgcacaaaaaggtcaga
gagaaagatgatcgatttcgccagcgcaaactacgtgatatgttcaatcctttggagaag
gacaggggggtgcagaatttggatgggacaggagatatggaagatttattaacgctggat
ggtggtatgagaaaaagtcatgtacccaatggttttggaaaagaaaataaaccaaacgac
gcaccatcaacagaagctggttcaaagcatagcaagaataaacaaaaatctataactagg
tcaaatgaaccccttgccgtacatattcaaaatgatgctgctgatgaacaagttgataga
agtactgattatcaaggatggcttgatgctaagaagagaaaatggaaatatgttcgtgag
caaaaaaagcgtcaaaggttgggtgctgcagtcacttctgatggtcccaccaatgatttg
ttttctgcaaggaatgtcggtcagttacatggcaatgctaggaaccggtctacatttttc
cagaaacaagaattggccctctttagatcacattggcagataatacagcttgcttcgagt
acattgcctggccacttttttgcatgggttgttgctgaggggatcatgttcaagattcct
atcaatgtgccaagagtcttttacctaaactcgaaagctcctgtcacagaagagtttcca
gggaggcgtgtaaagaagattcttccacatggaaggccatgtttcaatctcattgaggtt
gtaactagtgaagaacagttcagggtggagggcaaaaagcttgctgcccatcttgcagag
ccagatgttgagggaatatacgagacgaaaattctgccagagctcaatgccattctccaa
attggttgtgtgtgcaaagtggataagtctgcaaaaagacgaagtatccaagatggatgg
gatcttgctgaattgcaaatgaagacaactgcagagtgttcatacctggaacagaccgtt
tcatttttctatctataccacagcttgtcagaaggaaggggtgtatatgtcatgtacttc
cctacatctttcagaatacatgcagtggttgtcaatccgttccgcaataaagagctatcg
ccatcatttcttgaaaagcaatatcgagatgcttgtcaagctcttggctctctgcatgaa
aacatcactttccttgtggattaccacacatcaattgatgcaggtagcaagcatgtgcaa
agaatgttacttgaatacagacaacaacatcctggacctgtcataggcgtcatagaatgc
cctaaactccaagctctaaagtcagctgtacgggcacttgatgatttcccgtgtgtaacc
attccttgcaatgcacgggataacaactatcaggctcttggttggcaagcgacagctggt
agaacaagcatgcaacgttgtgctgcatcaacccaatggtttaatgaaagaatttcactt
gctagatatgcacatgtcccattgggaaactttgaactggattggcttcttttcaccgct
gacgtgttcttttcaagggcattgcgtgatcaacagcaggtactatggatatctgacgat
ggtattcccgatttaggaggcacatatgaaggagatacttgctttgctgatgaagtcatc
cagcctgctcttacttatcctggtgcgtatagacgagttgctgttgagcttaagatccat
catttggctgtcaattctctcctaaagagcagtcaagtagatgaaatggaaggagggccg
atcggtagctttgcaaatgacatgcctgctggtccaaatggcactgaaactgaattcgat
gatgctaccttatgtctacctgctttccaagtgctgaagcaactcattcagcgatgcatt
tcagatgcagtatcttctggaaatgtgtttgctgatgcaatattgcaacatctctaccgt
tggctttgcagcccacgatcgaaacttcatgacccagctctccatcatcttcttcataat
gtcatgaagaaggtctttgctctcatgttggcagagtttcgaaagcttggagctaatgtc
atctttgcgaacttttctaagataataatagatactggaaaagttgacctgttgtcagca
cgtgcatactgtgatagcttactgaaaacattgcagacaagggatatttttgagtgggtg
gagctggaacctttgcattattggcactccttacttttcatggaccagtataactatggt
ggtattcaggctaaaatgcaaaatgcaacatctgagggcagctcagatggtgataacgat
atcgacatcgtctcaagctggaacatagcagaatacctgcctaaagctacacaagatcac
tttgtcttaattgtatcggagtttttgtatgttccatggaaatacatgaaagaacaagta
gctcttcgatcaactacaagggatgagacctcatgcacaccatctataacaatcatggct
gctgaaaaccttgaggttcaagtcataggatatctccgtgatcagataagtaattacttt
gcagacaagcttctcaggattgtaagtgatatacttcatcatttcaaaggaaaaggcaag
tccgaatcagttgaacttacaaacagagaacctgatcctcacacacataagggagatgct
gcattagagttcattaagcatatatgtgctgttcttgctcttgatcagaatgttcagcat
gatattctgagaatgaggaagaacttgttaaagttagttcgtgtaaaggagtttgctcca
gaagcacagttccaagatccatgtgcctcattcactctccccaatgtgatttgcagctat
tgcaatgattgtcgggatcttgatctctgccgtgattcaacactccaaggtcaggagtgg
aggtgtgctgtgccgcagtgcgggcagccataccatcgtgaacagatggaaaatgcactt
ctacaggtagtccgtcagcgagagaggctctatcacttgcaggatttggtctgcctccgc
tgcaggcaagtgaaagcggcacacttatctgagcagtgctcctgtggaggtgcattccgg
tgcaaggaagaatcatcgcaattcctcagcaagatgcgggttttcctaaatgttgcggtc
agtcaaaagttcgagctgcttcaggatgttgtccaatggattctagaggtcagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337886
Entry
4337886           CDS       T01015                                 
Name
(RefSeq) DNA polymerase epsilon subunit 2
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4337886
   03410 Base excision repair
    4337886
   03420 Nucleotide excision repair
    4337886
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4337886
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337886
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4337886
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    4337886
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      4337886
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT DNA_pol_D_N
Other DBs
NCBI-GeneID: 4337886
NCBI-ProteinID: XP_015638793
UniProt: B9FML5
LinkDB
Position
5:3580565..3585628
AA seq 533 aa
MAAPSAATRRKLQRKFKLRGFTLKVDALEEAAAFLARFPDAEDDALDLLLDELDKEPLQS
SILDRDAVRRVVALLVEADEAVDAASPAATSARSALRVVDSFVVPRFHYDPIKKVFYEHT
SRLAIHGEAGDKAALYRDRYQVLLQRLARDIYFSKPAFDTVMTEDDNCEITSIQSLIGCT
GRRWIMGVISQLEERQFYLEDLTGAVPIDLSNAKITSGFFVENTVIVAEGELLSNGIFQV
NTCGFPPLEDREASLSMLMGLDFFGGGVIPTEETVRLSTLEKKAMNDMFVILSDVWLDNY
ETMEKLGVVLDGYDSLEAVPSLFVLMGNFCSRPCNLAFNSFEELRLQFGKLGEMIAARSR
LKEHSRFLFIPGPDDAGPSKALPRCALPKYLTEELQKHIPNAIFVSNPCRVKFYTQEIVF
FRQDLLYRMRRSCLIPPTTEETSDPFEHLVATITHQSHLCPLPLTVQPIIWSYDHCLRLY
PTPHTIVLGDKSDQKAFKYTGITCFNPGSFANDSTFAAYRPCTKEVELSALES
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcggcgccgtcggcggccacgcgcaggaagctgcagcgcaagttcaagctgcgaggc
ttcaccctcaaggtggacgccctcgaggaggccgccgccttcctcgcccgcttccccgac
gccgaggacgacgccctcgacctcctcctcgacgagctcgacaaggagccgctgcagtcg
tcgattcttgaccgggacgcggtgcggcgcgtggtggcgctgctcgtcgaggcggacgag
gcggtggatgcggcgtctccggcggccaccagcgcgcgctcggcgctgcgggtggtggat
tcgttcgtcgtgccaaggttccactacgatccgatcaagaaagtcttctacgagcatacc
agcagattagccatacatggagaagctggagataaagcagccctgtacagggacaggtat
caggttctgcttcagaggctagctcgtgatatatacttctctaagccagcttttgacact
gttatgaccgaagatgataattgtgagataacttctattcagtccctaattgggtgcact
ggtcggagatggattatgggggtcatatcacagttggaggaacgtcaattctacttggag
gatcttactggagctgtgccaattgacttatcgaatgctaaaatcacttcaggtttcttc
gttgaaaatactgtaattgtagcagaaggggaattgctttcaaatggcattttccaggta
aatacatgtggattccctcctttagaggatagagaagcatcactttcgatgcttatgggg
ctagatttcttcggtggaggtgtcataccaactgaagaaacagtaaggctatcaacctta
gagaagaaggccatgaatgatatgtttgttatactttcagatgtttggcttgacaattat
gagaccatggagaaattaggtgttgttcttgatggttatgatagtctagaagcagttcct
tccctttttgttttaatgggcaatttctgctcccggccctgcaatctggcattcaattca
tttgaagaactcagattgcagttcggaaagcttggtgagatgattgcagctcgatccagg
ttaaaggaacacagtcgttttttgttcattcctggtcctgacgacgcaggcccttctaaa
gcccttccaaggtgtgcacttccgaaatatctaactgaggaactgcagaagcacatccca
aatgcaatattcgtaagcaacccttgcagggtgaagttttatacacaagaaattgtattt
ttccggcaagacctcctttataggatgcggcggtcttgtctgattcccccaacaacagaa
gaaacaagtgaccctttcgagcatctggtagcaaccatcacccatcagagtcatctttgc
ccattgcctcttacagttcagccaatcatatggagctacgatcattgccttcgactctat
cctactcctcatacgatagtactgggcgacaagagcgaccagaaggccttcaaatacaca
ggaataacttgcttcaaccctggttcttttgctaacgatagcacctttgcagcttaccgt
ccttgcactaaggaggttgagctttctgcattagaaagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347894
Entry
4347894           CDS       T01015                                 
Name
(RefSeq) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4347894
   03410 Base excision repair
    4347894
   03420 Nucleotide excision repair
    4347894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4347894
   03036 Chromosome and associated proteins [BR:osa03036]
    4347894
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347894
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4347894
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    4347894
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    4347894
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      4347894
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C Amidase Bromo_TP TAF
Other DBs
NCBI-GeneID: 4347894
NCBI-ProteinID: XP_015611896
LinkDB
Position
9:complement(22690280..22692131)
AA seq 167 aa
MAGETGEGGGSHSQPEKQPGQAAAAASMAEAEVEELPKAIVRRLVKEKLAQVAAGGAEVI
VNKDAMSAFAESARIFIHYLSATANDMCKESKRQTINADDVLKALDEMEFPEFVEPLNTS
LQEFRNKNAARRSETTQKKAEKRRKIDKESLPQEQNDAADHGKTDED
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctggggagacgggggaaggtgggggatcccattcccaacctgagaagcagccgggc
caagcggcggcggcggcgtccatggcggaggcggaggtggaggagctgcccaaggccatc
gtgcggcgcctagtgaaggagaagctcgcccaggtcgccgccggaggggccgaggtcatc
gtcaacaaggacgccatgtccgccttcgccgagagcgcccgcatcttcatccactacctc
tccgccactgccaatgacatgtgcaaagaatcaaagaggcagacgatcaacgctgatgat
gtcctcaaggcactcgatgaaatggagttccctgagtttgtagagccccttaatacttct
ttgcaagaatttaggaacaaaaatgccgcccggagatcagaaacaacccaaaagaaagct
gaaaagagaaggaaaatagataaggagtcactgccacaagaacaaaacgatgcagctgat
catggcaagactgatgaggattaa

DBGET integrated database retrieval system