KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329463
Entry
4329463           CDS       T01015                                 
Name
(RefSeq) serine/threonine-protein kinase PBS1
  KO
K13430  serine/threonine-protein kinase PBS1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4329463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4329463
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4329463
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4329463
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH
Other DBs
NCBI-GeneID: 4329463
NCBI-ProteinID: XP_015627197
UniProt: Q6K603 A3A7B4
LinkDB
Position
2:18445943..18450509
AA seq 526 aa
MGCFSCFDSPAEEQLNPKVGGPYGGGSSSSAAAAAYGGGGGSSAGRHGERGGGYPDLHHH
HQQQQLPMAAPRVEKLSAGAEKTRVKSNAILREPSAPKDANGNVISAQTFTFRELATATR
NFRPECFLGEGGFGRVYKGRLESTGQVVAIKQLNRDGLQGNREFLVEVLMLSLLHHQNLV
NLIGYCADGDQRLLVYEYMHFGSLEDHLHDLPPDKEALDWNTRMKIAAGAAKGLEYLHDK
ANPPVIYRDFKSSNILLDESFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMT
GQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKMADPRLE
GRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYLASQSYDPNAAHASRKPGGDQR
SKVGENGRVVSRNDEASSSGHKSPNKDREDSPKEPPGILNKDFDRERMVAEAKMWGDRER
MVAEAKMWGDRERMVAEAKMWGENWRDKRRAIENGQGSLDSPTENG
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgggctgcttctcgtgcttcgactcgcccgcggaggagcagctgaaccccaaggtggga
gggccgtacggcggcggctcctcctcctccgccgccgcggccgcgtacggcggcggcggc
ggttccagcgctggtcggcatggggagaggggcggtggttacccggacctgcaccaccac
caccagcagcagcagctgcccatggcagcgccgcgcgtcgagaagctctccgcaggggct
gagaagacgagggtgaagagcaatgcaatactaagggaaccttctgcgcccaaggatgcc
aatgggaatgtaatatcagcacagactttcaccttccgagaactcgcgaccgccaccagg
aatttcaggccagagtgcttcctgggcgaaggaggctttgggcgcgtttataagggccgc
ctcgagagcactggccaggttgtggctataaagcagcttaatagagatgggcttcaagga
aacagagaatttctagtggaagttctaatgctcagtttgttacatcatcaaaatcttgtt
aatctgattggctattgtgctgacggagatcaacgtcttcttgtttatgaatacatgcac
tttggatcattggaagatcatttgcatgatctacctcctgataaggaagcattggattgg
aacacaaggatgaaaattgcggctggtgctgctaagggactagagtaccttcatgacaaa
gcaaatccaccagttatttatagagacttcaagtcatcaaacattctcttagatgagagt
ttccatccaaagctgtctgactttggtcttgcaaagttgggtcctgttggtgacaaatct
catgtctctactcgtgtgatgggaacatatggatattgtgctcctgagtatgctatgaca
ggacagttgacagttaagtctgatgtatatagctttggagttgtgttgcttgagttgatt
actggtcgtcgggcgatcgacagcactaggccacatggggagcaaaatcttgtctcatgg
gcacgacctcttttcaacgacagaagaaagctcccaaaaatggctgacccaagactggag
ggacgataccccatgcgtggactttaccaagcacttgcagtggcatctatgtgcattcag
tcggaggctgcgtcgcgtccacttattgcagatgttgtgactgctctttcctacctggca
tctcaatcatatgaccctaatgcggctcatgcttcaagaaagccaggtggcgatcagcga
agcaaggttggcgagaacggcagggtagtctccaggaacgacgaagccagcagctctggc
cacaagtcaccaaacaaggacagggaggattccccgaaagagcccccaggtatcctgaac
aaggatttcgacagggagcggatggtggcggaggcaaagatgtggggcgacagggaacgg
atggtggctgaggcaaagatgtggggtgatagggagcggatggtagccgaggcaaagatg
tggggcgagaattggcgggataagagacgtgcgatcgagaacgggcaggggagtctggat
tccccaactgaaaatggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335687
Entry
4335687           CDS       T01015                                 
Name
(RefSeq) serine/threonine-protein kinase CDL1 isoform X1
  KO
K13430  serine/threonine-protein kinase PBS1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4335687
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4335687
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4335687
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4335687
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 4335687
NCBI-ProteinID: XP_015633694
LinkDB
Position
4:19365793..19371137
AA seq 484 aa
MGCFPCFDSRMGEEEEEELYYGKGGARGGGNGGGALSAAAAAASSSSGVGGGGWEGTSTA
APRVEKISAGARGRGNATVKKELSALKDANGNVISAQTFTFRQLAAATRNFREECFIGEG
GFGRVYKGRLDGTGQIVAIKQLNRDGTQGNKEFLVEVLMLSLLHHQNLVNLVGYCADGDQ
RLLVYEYMPLGSLEDHLHDLPPDKVPLDWNTRMKIAAGAAKGLEYLHDKAQPPVIYRDFK
SSNILLGEDFHPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYS
FGVVLLELITGRKAIDSTRPHVEQNLVSWARPLFNDRRKLPKMADPGLEGRYPMRGLYQA
LAVASMCIQSEAASRPLIADVVTALSYLASQKYDPNTTPSSKKAGGGEAGRALSRNDEAG
SSGHKSPSSKDSPREQQLPGILNDRERMVAEAKMWGENWREKRRAAATTSSNAQVSLDSP
TETG
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgggttgcttcccgtgcttcgattcgaggatgggggaggaggaggaggaggagctgtac
tacgggaaggggggagcgcgcggcggaggcaatgggggtggcgctttgtcggctgctgct
gcggcggcgtcgtcgtcctccggcgtcggcggcggtgggtgggaggggacgtctacggcg
gcgccgcgcgtcgagaagatctccgcaggggctagggggagaggcaatgccaccgtgaag
aaggagctctcggctctcaaggatgccaatggcaatgtcatctccgcgcagacgttcacc
ttccgccagctcgccgcggcgacgaggaacttcagggaggagtgcttcattggggaagga
gggtttgggcgcgtttacaagggccggttggacggcactggccagattgttgctataaaa
cagctcaatagggatggtactcaaggaaacaaagaatttctagtggaggttctcatgctt
agtttgctgcatcatcaaaaccttgttaatttggttggttattgcgccgatggagatcaa
cgccttcttgtgtacgagtacatgcccctcggatcattggaagatcatttgcatgatctc
cctcctgataaggttcccttggattggaacactaggatgaaaatcgcagcaggtgcggct
aaaggtctggagtaccttcatgacaaggctcaaccaccagttatatatagggacttcaag
tcatcaaatattctattgggcgaggatttccatccaaagctttcagactttggtcttgct
aaattgggtcccgttggtgacaagtctcacgtctctacacgtgtgatgggaacatatgga
tattgtgctccggaatatgctatgacgggacagcttacagttaaatcggatgtttatagc
ttcggagtagtcctgcttgagttgattactggccggaaggccattgacagtaccagacca
catgtagaacaaaaccttgtctcatgggcgcgacctcttttcaacgacaggcggaagctc
ccaaagatggctgacccggggctggagggacgatatccgatgcgcgggctctaccaagcg
ctcgcggtggcatcaatgtgcatccagtcggaggccgcgtcccgacctctcatcgccgat
gttgtgaccgcgctctcctacctggcgtcccagaagtacgatcccaacacgacgccgtcc
tcaaagaaggccggcggtggcgaggccgggagggcgctgtccaggaacgacgaggcgggc
agctccggccacaagtcgccgtcgagcaaggactccccccgggagcagcagctcccgggg
atcctcaacgacagggagaggatggtggcggaggcgaagatgtggggggagaactggcgg
gagaagaggcgcgccgccgccaccacctccagcaatgcccaggtgagcctggattcgcct
accgaaaccggttaa

DBGET integrated database retrieval system