KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329532
Entry
4329532           CDS       T01015                                 
Name
(RefSeq) 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4329532
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4329532
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     4329532
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4329532
SSDB
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase DUF5696
Other DBs
NCBI-GeneID: 4329532
NCBI-ProteinID: XP_015627503
UniProt: A0A222NP86 Q6H6P8
LinkDB
Position
2:complement(19355808..19367580)
AA seq 825 aa
MAAPASAVPGSAAGLRAGAVRFPVPAGARSWRAAAELPTSRSLLSGRRFPGAVRVGGSGG
RVAVRAAGASGEVMIPEGESDGMPVSAGSDDLQLPALDDELSTEVGAEVEIESSGASDVE
GVKRVVEELAAEQKPRVVPPTGDGQKIFQMDSMLNGYKYHLEYRYSLYRRLRSDIDQYEG
GLETFSRGYEKFGFNHSAEGVTYREWAPGAHSAALVGDFNNWNPNADRMSKNEFGVWEIF
LPNNADGSSPIPHGSRVKVRMETPSGIKDSIPAWIKYSVQAAGEIPYNGIYYDPPEEEKY
IFKHPQPKRPKSLRIYETHVGMSSTEPKINTYANFRDEVLPRIKKLGYNAVQIMAIQEHA
YYGSFGYHVTNFFAPSSRFGTPEDLKSLIDKAHELGLVVLMDVVHSHASNNTLDGLNGFD
GTDTHYFHSGSRGHHWMWDSRLFNYGNWEVLRFLLSNARWWLEEYKFDGFRFDGVTSMMY
THHGLQVAFTGNYSEYFGFATDADAVVYLMLVNDLIHGLYPEAITIGEDVSGMPTFALPV
QDGGVGFDYRLHMAVPDKWIELLKQSDESWKMGDIVHTLTNRRWSEKCVTYAESHDQALV
GDKTIAFWLMDKDMYDFMALDRPATPSIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGH
PEWIDFPRAPQVLPNGKFIPGNNNSYDKCRRRFDLGDADYLRYRGMLEFDRAMQSLEEKY
GFMTSDHQYISRKHEEDKMIIFEKGDLVFVFNFHWSNSYFDYRVGCLKPGKYKVVLDSDA
GLFGGFGRIHHTAEHFTADCSHDNRPYSFSVYSPSRTCVVYAPAE
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggcggcgccggcgtctgcggttcccgggagcgcggcggggctacgggcgggggccgtg
cggttccccgtgccagccggggcccggagctggcgtgcggcggcggagctcccgacgtcg
cggtcgctgctctccggccggagattccccggtgccgttcgcgtggggggttccgggggg
cgcgtggccgtgcgcgcggcgggcgcgtcaggggaggtgatgatccccgagggcgagagc
gacgggatgccggtttcagcaggttcagacgatctgcagttgccagccttagatgatgaa
ttaagcacggaggttggagctgaagttgagattgagtcatctggagcaagtgacgttgaa
ggcgtgaagagagtggttgaagaattagctgctgagcagaaaccacgagttgtcccacca
acaggagatgggcaaaaaatattccagatggactctatgcttaatggctataagtaccat
cttgaatatcgatatagcctatataggagactgcgttcagacattgatcagtatgaagga
ggactggaaacattttctcgcggttatgagaagtttggatttaatcacagtgctgaaggt
gtcacttatcgagaatgggctcccggggcacattctgcagcattagtaggtgacttcaac
aattggaatccaaatgcagaccgcatgagcaaaaatgagtttggtgtttgggagattttt
ctgcctaacaatgctgatggctcatctcctattccacatggctcacgtgtaaaggtgcga
atggaaactccatctggtataaaggattctattcctgcctggatcaagtactctgtgcag
gccgcaggagaaatcccatacaatggaatatattatgatcctcctgaagaggagaagtac
atattcaagcatcctcaacctaaaagaccaaagtcattgcggatatacgaaactcatgtt
ggaatgagtagcacggagccaaagatcaacacgtatgcaaactttagggatgaggtgctt
ccaagaatcaaaaagcttggatacaatgcagtgcaaataatggcaattcaagagcatgca
tattatggaagctttgggtaccatgtcaccaatttctttgcaccaagtagtcgtttcggg
accccagaagatttaaagtcattgattgataaagctcatgagcttggtttagttgtgctc
atggatgttgttcacagccatgcgtcaaataataccctagatgggttgaacggttttgat
ggtacagatacgcattactttcatagtggttcacgcggccatcattggatgtgggattct
cgccttttcaactatgggaattgggaagttctaagatttctactatccaatgcaagatgg
tggctcgaggagtataagtttgatggtttcagatttgacggtgtaacctcaatgatgtac
actcatcatggattacaagtagcatttacggggaactacagtgaatactttggatttgcc
actgatgctgatgcagtagtttacttgatgctggtaaatgatttaattcatggactttat
cctgaggccataaccatcggtgaagatgtcagtggaatgcctacatttgcccttcctgtt
caagatggtggggttggttttgattatcgccttcatatggctgttcctgacaaatggatt
gaactcctcaagcaaagtgatgaatcttggaagatgggtgatattgtgcacacactgact
aacagaaggtggtcagagaagtgtgttacttatgctgaaagtcatgatcaagcactagtt
ggtgacaaaactattgcattctggttgatggacaaggatatgtatgattttatggctctg
gacagaccggcaacacctagcattgatcgtggaatagcattgcataaaatgattagactt
atcacaatggggttaggaggagaaggctatcttaactttatgggaaatgagttcggacat
cctgaatggattgattttccaagagctccacaagtacttccaaatggtaaattcatccca
gggaataacaacagttatgataaatgccgtcgaagatttgacctgggtgatgcggactat
cttaggtatcgtggcatgctagagtttgaccgcgcgatgcagtctctcgaggaaaaatat
gggttcatgacatcagaccaccagtacatatctcgaaagcatgaagaggataagatgatt
atatttgagaagggagatctggtatttgtgttcaacttccattggagtaacagctatttt
gactaccgtgttggttgtttaaagccagggaaatataaggtggtcttggactcagatgct
ggactctttggtggatttggcaggatccatcacactgcagagcacttcactgccgattgt
tcacatgacaacaggccctactcgttctcagtttattctcctagcagaacctgcgttgtc
tatgctccagcggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341008
Entry
4341008           CDS       T01015                                 
Name
(RefSeq) 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic isoform X1
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4341008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341008
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     4341008
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4341008
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase CBM_48 DUF386 FBA_3
Other DBs
NCBI-GeneID: 4341008
NCBI-ProteinID: XP_015644348
LinkDB
Position
6:15335692..15365532
AA seq 913 aa
MDSCALFLSTPRPPPPLVPAHRRRPLASRSGLRRREGCPCSCASSSSSSGRAGSQDRPPR
PWQQKQRTQRPGRGEAIDPVGFLAKHGISDRAFAQFLRDRYKALKDRRWELHSRLIDLKE
ASSGFELMGMHRHRQHRVDFMEWAPGARYCSVVGDFNQWSTTENCAREGHLGHDDFGYWT
IILEDKLREGQEPDEYYFQEYNYADDYDKGDNGVDVEELIHRMNEEYWEPGEIKSQKSRL
EVVAKLYEQMFGPNGPQTEEELGDIPDAETRYNEWKALQKDDSASSLPCYDIIDNGQEFD
IFNVATDRVSFEKFQGKSPPLAYWVEMRKGRKAWLEKYVPAISHKDKYRVYFNTPDGGLE
RIPAWATYVLPGSPNLSFFCVDAEGKQSYAVHWDPPPEEIYKWRFERPKVKGSLRIYECH
VGISGSEQKISSFQEFTSNVLPHIKDAGYNAIQLIGIVEHKDYSSVGYKVTNYFSVSSRF
GSPDDFKKLVDEAHGLGLVVLLDIVHSYASADELVGLSLFDGSNDCYFHSGKRGHHKYWG
TRMFKYDDIDVLHFLLSNLNWWVTEYRVDGFQFHSLPSMLYTHNGFSTFTGATEEYYNQY
VDEDALIYLIIANEMLHELHPDIITIAEDATFYPGLCEPTTQGGLGFDYWVNLSIPEMWL
WHLENVPEQEWSMNKIMRVLVNNNSNMLSYVENHNQSISGRKSFAEIILYEGKCSNSSVD
NDLIFRASSLLNIIKLITFTTSGGAYLNFIGNEFAHPKRIEFPMSSNDYSFCLANRQWEL
LDKGVHKHIFNFDKDIMSLDGKERLISGGSPIVHHCDDTSMIIYFTRGPFLFVFNFNPDA
SYQLYSVGVDEAGEYQLILNTDETKYGGRGELTSNQYMKRTSDNRVGGCRNSLELTLPSR
SAQVFKLVRILRI
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggattcttgcgctctcttcctctctaccccgcgaccacctcctcctctcgtccccgcg
caccgccgccgacccctcgcgagccgctcaggcctccgccgccgggagggttgcccctgc
agctgcgcctcctcctcttcctcctccggtcgtgccggttctcaggaccgcccgcccagg
ccttggcagcagaagcagcggacgcagcgtcccggccgcggcgaggccatcgacccagtc
ggcttcctcgccaagcacggcatctccgaccgcgcgttcgcgcagttcctccgtgaccgg
tacaaagctttgaaagaccgtcgatgggagctgcactctcgtctaattgatctgaaagag
gcatcttctgggtttgagttaatgggcatgcatcgacatcggcagcaccgtgtggatttc
atggagtgggcaccaggtgctcgttattgttctgtagtgggtgattttaatcagtggtca
actactgaaaattgtgcacgcgaaggtcatttgggacatgatgattttggatattggact
atcatacttgaagataaacttagggaagggcaagaaccagatgaatattatttccaagag
tacaactacgcagatgattatgacaaaggtgataatggtgttgatgtggaagaattgatc
cacagaatgaacgaagagtattgggaacctggagaaattaagtcacagaagtctcggtta
gaggtggttgctaagctatatgagcaaatgtttggtccaaatggtccacaaacagaggag
gaactaggtgacatacctgatgctgaaacaagatataatgagtggaaagccttgcagaag
gatgattcagcaagttcgttgccttgctatgatatcattgataatgggcaggagtttgac
attttcaatgttgcaaccgatcgagtgtcatttgaaaaatttcaaggaaaatcaccacct
cttgcttactgggttgaaatgaggaaagggcgaaaagcttggttggagaaatatgttcca
gcaatttctcataaagacaagtaccgtgtttattttaacactcctgatggtggtttggaa
cgcattcctgcttgggctacttatgttcttccaggttctcccaacttatcatttttttgt
gtagatgctgaagggaagcagtcctatgcagtacactgggatcctcctccagaagaaatt
tataaatggagatttgaacggccgaaggtcaaaggttcacttaggatatacgaatgtcat
gttggaataagtggatcggagcaaaaaatatcgtcatttcaggagttcacatcaaatgtc
ctccctcatataaaagatgctggctataatgctattcaattgattggaattgtggaacac
aaggattactcttctgttggctataaggtcaccaattatttttcagtcagtagcagattt
ggctcgccagatgacttcaaaaaactagtggatgaggcacacggccttggattagtggtg
cttcttgatattgtccactcctatgcatcagcagatgaattggttggcttatccctcttt
gatggttctaatgattgttacttccacagcggaaaacgagggcaccacaaatactggggt
accagaatgttcaaatatgatgatattgatgttctacacttcttattgtctaatttaaat
tggtgggtcactgaataccgtgttgatggattccagtttcactcactgccttctatgtta
tatactcataatggcttttctactttcactggtgccactgaagagtattacaatcaatac
gtcgatgaggatgcgctgatatatttaattatagcaaatgagatgttgcatgagcttcat
ccagatattataacaatagctgaggatgcaacattttatcctgggctatgtgagccaacc
actcaaggcggattaggatttgattactgggtcaatctttcaattcctgaaatgtggttg
tggcatcttgaaaatgttcctgagcaagaatggagcatgaataagattatgagagtacta
gtaaacaacaacagtaatatgctatcttacgtcgaaaatcacaaccagtcaatatcaggg
cggaaatcttttgctgaaataattctttatgaaggaaagtgttcaaatagttctgttgac
aatgatttgattttcagggcttcctcattgctcaatataatcaaactaattacttttaca
acaagtggtggtgcatatctcaacttcattggaaatgaatttgcacatccaaagagaatt
gagtttcctatgtcaagcaatgactattccttctgcctagctaatcggcaatgggaactg
ctggacaagggtgtccataaacatatattcaactttgacaaggatatcatgagcttagat
ggcaaagagaggctaatttctgggggttcacccattgttcatcactgtgatgacactagc
atgatcatatattttactagaggacctttcctttttgttttcaatttcaatcctgacgcc
tcctatcagctctattctgttggtgtggatgaagctggtgaatatcagcttatattgaac
acagatgaaactaaatatggtggacgtggggagctgacgagcaatcaatatatgaaaaga
accagtgacaatagggttggtggttgccgcaactccttggaattgacattaccatctagg
agtgctcaggtattcaagttggtccgaattttgagaatttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342117
Entry
4342117           CDS       T01015                                 
Name
(RefSeq) 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic isoform X1
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4342117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342117
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     4342117
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4342117
SSDB
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase DUF5696
Other DBs
NCBI-GeneID: 4342117
NCBI-ProteinID: XP_015643111
UniProt: Q01401 Q0D9D0 A1YQH7
Structure
LinkDB
Position
6:complement(30898176..30905822)
AA seq 820 aa
MLCLTSSSSSAPAPLLPSLADRPSPGIAGGGGNVRLSVVSSPRRSWPGKVKTNFSVPATA
RKNKTMVTVVEEVDHLPIYDLDPKLEEFKDHFNYRIKRYLDQKCLIEKHEGGLEEFSKGY
LKFGINTVDGATIYREWAPAAQEAQLIGEFNNWNGAKHKMEKDKFGIWSIKISHVNGKPA
IPHNSKVKFRFRHGGGAWVDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRP
PKPDAPRIYEAHVGMSGEEPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGY
HVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHE
SYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHG
INKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGG
VGFDFRLAMAIPDRWIDYLKNKEDRKWSMSEIVQTLTNRRYTEKCIAYAESHDQSIVGDK
TIAFLLMDKEMYTGMSDLQPASPTINRGIALQKMIHFITMALGGDGYLNFMGNEFGHPEW
IDFPREGNNWSYDKCRRQWSLVDTDHLRYKYMNAFDQAMNALEEEFSFLSSSKQIVSDMN
EKDKVIVFERGDLVFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVD
HFTSPEGMPGVPETNFNNRPNSFKVLSPPRTCVAYYRVDEDREELRRGGAVASGKIVTEY
IDVEATSGETISGGWKGSEKDDCGKKGMKFVFRSSDEDCK
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgctgtgtctcacctcctcttcctcctccgcgcccgctccgctccttccctctctcgct
gatcgaccgagcccgggaatcgcgggcgggggtggcaatgttcgcctgagcgtggtttct
tcgccgcgccggtcgtggcctggaaaggtcaagaccaatttctcagttcctgcgactgcg
cgaaaaaacaaaaccatggtgactgttgtggaggaggtcgaccaccttcctatatatgat
ctggaccctaagttggaggaattcaaggatcacttcaactataggataaaaagatacctc
gaccagaaatgcctgattgaaaaacatgaggggggccttgaagaattttctaaaggctat
ttgaagtttgggattaatacagttgatggtgccacaatatatcgtgaatgggcgcctgct
gcacaagaagcacagctcattggtgagttcaataactggaatggtgcaaaacacaagatg
gagaaggataaatttggcatttggtcaatcaagatttcacatgtcaatgggaagcctgcc
atccctcacaattccaaggttaaatttcgctttaggcatgggggtggagcatgggttgat
cgtattcccgcatggattcgttatgcaacttttgatgcctctaaatttggagctccatat
gatggtgtacactgggatcctccagcctgtgaaaggtacgtgtttaagcatcctcgacct
ccaaaacctgatgctccacgcatctatgaggctcatgtggggatgagtggtgaagagcca
gaagtaagcacatacagagaatttgcagacaatgtgttaccacgcatacgggcaaataac
tacaacacagttcagttaatggcaatcatggaacattcctactatgcttcttttgggtat
cacgtgacaaattttttcgcagtcagcagcagatcaggaacaccagaggatctgaaatat
cttgttgacaaggcacatagtttaggattacgagttctgatggatgttgtccatagccat
gcgagtaataatgtgaccgatggtctaaatggctatgacgttggacaaaacactcatgag
tcttattttcatacaggagataggggctaccataaactctgggatagtcgtctgttcaac
tatgccaattgggaggtcttaagatttcttctttctaatttgagatattggatggacgaa
ttcatgtttgatggcttccgatttgatggggttacatcaatgctataccatcaccatggt
atcaataagggatttactggaaactacaaggagtatttcagtttggataccgatgtggat
gcaattgtttacatgatgctcgcaaaccatttaatgcataaactcttgccggaagcaact
attgttgctgaagatgtttcgggcatgccagtgctttgtcggccagttgatgaaggtgga
gtagggtttgacttccgcctggcaatggccattcctgatagatggattgactacctgaag
aacaaagaggaccgcaaatggtcaatgagtgaaatagtgcaaactttgactaacaggaga
tatacagaaaaatgcattgcctatgccgagagccatgatcagtccattgttggtgacaag
actatagcatttctcttgatggacaaggaaatgtacactggcatgtcagacttgcagcct
gcttcacctaccatcaaccgtggcattgcactccaaaagatgattcacttcattacgatg
gcccttggaggtgatggctacttaaattttatgggcaatgagtttggccatccagaatgg
attgactttccaagagaaggcaacaactggagctatgataaatgcagacgtcagtggagc
cttgtcgacactgatcaccttcgatacaagtatatgaatgcatttgatcaagcaatgaat
gcactcgaggaggaattttccttcctgtcatcatcaaagcagattgttagcgacatgaac
gagaaagataaggttattgtctttgaacgtggagatttggtttttgttttcaattttcat
cccaacaaaacttacaagggttacaaagtcggatgtgacttgcccgggaagtacagagta
gctctggactctgatgctttggtctttggtggccatggaagagttggccatgatgtggat
cacttcacgtctcccgagggaatgccaggagtaccagaaacaaatttcaacaaccgccct
aactcattcaaagtcctttccccgccccgtacctgtgtggcttactatcgcgttgatgaa
gatcgtgaagagctcaggaggggtggagcagttgcttctggaaagattgttacagagtat
atcgatgttgaagcaacaagtggggagactatctctggtggctggaagggctccgagaag
gacgattgtggcaagaaagggatgaagtttgtgtttcggtcttctgacgaagactgcaaa
tga

DBGET integrated database retrieval system