KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329561
Entry
4329561           CDS       T01015                                 
Name
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4329561
   00500 Starch and sucrose metabolism
    4329561
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4329561
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4329561
NCBI-ProteinID: XP_015625273
UniProt: Q0E0P0
LinkDB
Position
2:19682533..19687250
AA seq 577 aa
MGTRLLALAPWLLLLLLQLAGASHVVHRSLEAEQAPSSVPASIVSPLLRTGYHFQPPMNW
INDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLINWIALEPAIKPDIPSDQYG
CWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNASDPLLREWVKPAYNPVATPEP
GMNATQFRDPTTAWYADGHWRMLVGGLKGARLGLAYLYRSRDFKTWVRAKHPLHSALTGM
WECPDFFPLQAPGLQAGLDTSVPSSKYVLKNSLDLTRYDYYTVGIYNKVTERYVPDNPAG
DYHRLRYDYGNFYASKTFFDPVKHRRILLGWANESDSVTYDKAKGWAGIHAIPRKVWLDP
SGKQLLQWPIEELETLRGKSVSVFDKVVKPGEHFQVTGLGTYQADVEVSLEVSGLEKAEA
LDPAFGDDAERLCGAKGADVRGGVVFGLWVLASAGLEEKTAVFFRVFKPAGHGAKPVVLM
CTDPTKSSLSPDLYKPTFAGFVDTDISSGKISLRSLIDRSVVESFGAGGKTCILSRVYPS
MAIGDKAHLYVFNNGEADIKISHLKAWEMKKPLMNGA
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgcc
ggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccg
gcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactgg
atcaacgatccgaacgggccactgtattacaagggatggtaccacctattctaccagtac
aaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctc
atcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggt
tgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactggg
atcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtca
gacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcct
ggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattgg
cggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagc
cgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatg
tgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacaca
tctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactac
tacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggc
gactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgac
ccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctac
gacaaggcgaagggctgggccggcatccatgcgatcccaagaaaggtatggctggacccg
agcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcg
gtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcgga
acctaccaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcg
ttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtg
aggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaacc
gccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatg
tgcaccgaccctaccaagtcttctcttagcccggatctctacaagccaacttttgccggg
ttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttgattgaccgttcg
gtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcg
atggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaag
atttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335789
Entry
4335789           CDS       T01015                                 
Name
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4335789
   00500 Starch and sucrose metabolism
    4335789
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4335789
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4335789
NCBI-ProteinID: XP_015635053
UniProt: Q0JDC6
LinkDB
Position
4:20412321..20414897
AA seq 586 aa
MATARARAALVFVALLQMAAVVVVRASHVVYPELQSLEAKHVDGKLRTGYHFQPPKHWIN
DPNGPMYYKGLYHLFYQYNPKGAVWGNIEWAHSVSTDLIDWTALEPGIYPSKTFDEKGCW
SGSATVLPSGVPVIMYTGIDPDERQVQNVAYPVNLSDPYLREWYKPDYNPIINPDGGINA
SAFRDPTTAWYGPDGHWRLLVGSKVNMKGLAVLYRSRDFKKWVKAHHPLHSAHTGMWECP
DFFPVAVAGGSRHYRRGVDTAELHDAAVAEEVKYVLKVSLDLTRYEYYTVGWYDHATDRY
VPDAAFPDNDYGLRYDYGDFYASKSFYDPAKRRRIVWGWANESDTVPDDRRKGWAGIQAI
PRKLWLSADGKQLVQWPVEELKALRAKHVNVTDKVIKKGNYFEVTGFKSVQSDVDMAFAI
KDLSKAEEFDPAWRTDAEALCKKLGSDVDGGVGPFGLWALASGDLKERTAVFFRVFKAND
SSHVVLMCNDPTRSSYESKIYRPTFAGFVDVDIAKNKQIALRTLIDHSVVESFGARGKTC
ILTRVYPRKAVGDDAHLFVFNNGESDVKVTNLDAWEMKTPKMNAEE
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcgacggcgagggcgagggccgcgctggtgtttgtggctctgctgcagatggcggca
gtggtggtggtgcgcgcgtcgcacgtcgtctacccggagctccagtcgctggaggcgaag
cacgtcgacgggaagctccggaccgggtaccacttccaaccacccaagcactggatcaac
gatccgaacggtccgatgtactataagggcttgtaccatctgttctaccagtacaacccc
aagggcgccgtgtgggggaacatcgagtgggcgcactcggtttcgacggacctgatcgac
tggacggcgctggagccggggatctacccgtccaagacgttcgacgagaagggctgctgg
tcgggctccgccaccgtgctccccagcggcgtgccggtgatcatgtacaccggcatcgac
cccgacgagcggcaggtccagaacgtcgcctacccggtgaacctctccgacccgtacctc
cgcgagtggtacaagcccgactacaaccccatcatcaacccggacggcggcatcaacgcc
agcgcgttccgcgacccgaccaccgcctggtacgggcccgacggccactggcggctcctc
gtcggcagcaaggtgaacatgaaggggctcgccgtgctgtaccggagccgggacttcaag
aagtgggtcaaggcgcaccacccgctgcactcggcgcacaccgggatgtgggagtgcccg
gacttcttccccgtcgctgtggcgggcgggagccgccactaccgccgcggcgtcgacacc
gccgagctgcacgacgccgccgtggcggaggaggtcaagtacgtgctcaaggtgagcctc
gacctgacgcggtacgagtactacaccgtcggctggtacgaccacgccaccgaccggtac
gtccccgacgccgccttccccgacaacgactacggcctccgctacgactacggcgacttc
tacgcatccaagtcgttctacgacccggccaagcgccgccgcatcgtctggggctgggcc
aacgagtccgacaccgtacccgacgaccgccgaaagggctgggccggcatccaggcgata
ccgaggaagctctggctgtcggcggacgggaagcagctggtgcagtggccggtggaggag
ctcaaggcgctgcgagccaagcacgtcaatgtcactgacaaggtcatcaagaagggcaac
tacttcgaggtcaccggcttcaagtccgtgcagtcggatgtggatatggcgttcgcgatc
aaggacctgagcaaggcggaggagttcgacccggcgtggcggacggacgcggaggcgctg
tgcaagaagctcggctcggacgtcgacggcggcgtggggccgttcgggctgtgggcgctg
gcctccggcgacctcaaggagaggacggccgtcttcttcagggtgttcaaggccaacgac
tcctcgcacgtcgtcctcatgtgcaacgaccctaccaggtcatcgtacgagtcgaagatc
tacaggccgaccttcgccggcttcgtcgacgtcgacatcgccaagaacaaacaaatcgcc
ctccggacattgatcgatcactccgtggtggagagcttcggggcgcgcggcaagacgtgc
atcctgacgagggtgtacccgaggaaagccgtcggcgacgacgcgcacctcttcgtcttc
aacaacggcgagtcggacgtcaaggtcaccaacctggacgcctgggagatgaagaccccg
aagatgaacgcggaggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335790
Entry
4335790           CDS       T01015                                 
Name
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4335790
   00500 Starch and sucrose metabolism
    4335790
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4335790
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4335790
NCBI-ProteinID: XP_015633534
UniProt: Q0JDC5 B5KNJ4 A0A8J8YLL2
LinkDB
Position
4:20422158..20427033
AA seq 598 aa
MGVLGSRVAWAWLVQLLLLQQLAGASHVVYDDLELQAAATTADGVPPSIVDSELRTGYHF
QPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHSVSRDLINWVALKPAIEPSI
RADKYGCWSGSATMMADGTPVIMYTGVNRPDVNYQVQNVALPRNGSDPLLREWVKPGHNP
VIVPEGGINATQFRDPTTAWRGADGHWRLLVGSLAGQSRGVAYVYRSRDFRRWTRAAQPL
HSAPTGMWECPDFYPVTADGRREGVDTSSAVVDAAASARVKYVLKNSLDLRRYDYYTVGT
YDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFYDPAKRRRILWGWANESDTAADDVAKG
WAGIQAIPRKVWLDPSGKQLLQWPIEEVERLRGKWPVILKDRVVKPGEHVEVTGLQTAQA
DVEVSFEVGSLEAAERLDPAMAYDAQRLCSARGADARGGVGPFGLWVLASAGLEEKTAVF
FRVFRPAARGGGAGKPVVLMCTDPTKSSRNPNMYQPTFAGFVDTDITNGKISLRSLIDRS
VVESFGAGGKACILSRVYPSLAIGKNARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGA
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgggagttcttggtagtagggtcgcttgggcatggctggtccagctgctgctgctccag
cagctcgccggagcgtcgcacgtcgtctacgacgacctcgagctgcaggcggctgctacc
acagcggacggcgtgccgccgtccatcgtcgactctgagctccggactgggtatcacttc
cagccacccaagaactggatcaatgatccgaacgcgccgatgtactacaaggggtggtac
catctgttctaccagtacaaccccaagggcgccgtgtgggggaacatcgtgtgggcgcac
tcagtgtcacgtgacctcatcaactgggtggcgctcaagccggccatcgagcccagcatc
agggccgacaagtacggctgctggtcggggtcggcgacgatgatggccgacgggacgccg
gtgatcatgtacaccggcgtcaaccgccccgacgtcaactaccaggtgcagaacgtggcg
ctgccgaggaacgggtcggacccgctgctgcgcgagtgggtgaagcccggccacaacccg
gtgatcgtgcccgagggcggcatcaacgcgacgcagttccgcgacccgaccaccgcgtgg
cgcggggccgacggccactggcggctgctcgtcggcagcctcgcggggcagtcccgcggc
gtggcgtacgtgtaccggagcagggacttccggcggtggacgcgcgcggcgcagccgctg
cactcggcgcccacggggatgtgggagtgcccggacttctacccggtcaccgcggacggc
cgccgcgagggcgtcgacacctcgtccgccgtcgtcgacgccgccgcctcggcgcgcgtc
aagtacgtgctcaagaacagcctcgacctgcgccggtacgactactacaccgtcggaacg
tacgaccggaaggccgagcggtacgtgccggacgaccccgccggcgacgagcaccacatc
cgctacgactacggcaacttctacgcctccaagacgttctacgacccggcgaagcgccgc
cgcatcctctggggatgggccaacgagtccgacaccgccgccgacgacgtggccaagggc
tgggccggaatccaggcgattccgaggaaagtgtggctggacccaagtgggaagcaactg
ttgcagtggccaatcgaggaggtcgagaggctgagagggaagtggccggtcattctcaag
gacagggtggtcaagccaggggaacacgtcgaggtgaccgggctacaaactgcacaggct
gacgtggaggtgagcttcgaggtggggagcctggaggcggcggagcggctggacccggcg
atggcgtacgacgcgcagcggctgtgcagcgcgcggggcgccgacgcgaggggcggcgtg
gggccgttcggcctgtgggtgctcgcgtccgcggggctggaggagaagaccgccgtgttc
ttcagggtgttcaggccggcggcgcgcggcggcggcgccggcaagcccgtcgtgctcatg
tgcaccgaccccaccaagtcatcgcgcaacccgaacatgtaccagccgacgtttgcaggg
ttcgttgacacggacatcaccaacgggaagatatctctgaggagcctgatcgacaggtcg
gttgttgagagcttcggggctggaggaaaggcgtgcatcctgtcgagggtgtacccgtcg
ctggccatcggcaagaacgcgcgcctttacgttttcaataacgggaaggcggagatcaag
gtgtcgcagctcaccgcgtgggagatgaagaagccggtcatgatgaatggagcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336515
Entry
4336515           CDS       T01015                                 
Name
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4336515
   00500 Starch and sucrose metabolism
    4336515
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4336515
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C INV_N FLgD_tudor
Other DBs
NCBI-GeneID: 4336515
NCBI-ProteinID: XP_015636934
UniProt: Q0JBF1 A0A0P0WCW5
LinkDB
Position
4:26765183..26771886
AA seq 656 aa
MIPAISPMMDGAAPLLPETSPESRQQRDPERGKRRTPVLPAVVASAVVLLGLAALFLVYG
FHDGGDGRAAVLAPGTVEVAASSSRGVVEGVSEKSTTPALRLGGGAVRDYAWTNSMLSWQ
RTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPL
AMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKA
EANPVLVPPPGIGLTDFRDPTTAWRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDL
LPTLLHVVKGTGMWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAI
GTYDGETDTWTPDNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADI
LKGWASLQSIPRTVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPLDVGKA
TQLDIEAVFEVDTSAADGVVTEAGAAAYSCGTGGGAVGRGLMGPFGLLVLADDQLSERTA
VFFYLVKGVDGNLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVDHSIVEG
FAQGGRTCITSRVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELNSAYIRPYVD
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgatcccggccatctccccgatgatggacggcgccgcgcctctgcttcccgagacgagc
cccgagagccgccagcaacgtgatccggagagggggaagaggcggacgccggtcctcccg
gccgtcgtcgcgtccgccgtggtccttctcggcctcgcggcgctcttcctggtgtatgga
tttcacgacggtggagacgggagggcggccgtactcgcgcccggcaccgtggaggtcgcg
gcctcgtcgtcccgcggcgtcgtggagggcgtctcggagaagtccaccaccccggcgctg
cgcctcggcggcggcgcggtccgggactacgcctggaccaactcgatgctgtcctggcag
cgcacggcgttccacttccagccccccaacaattggatgaacgatccgaacggtccactg
tactacaagggatggtaccatctgttctaccaatggaacccggactcggccgtgtggggg
aacatcacctggggccatgccgtgtcgcgcgatctcatccactggctgcacctgccgctc
gccatggtgcccgaccactggtacgacatcaacggcgtctggaccggctcggcgacgcag
ctgcccgacggccggatcgtcatgctctacaccggcgccacggaggagtcggtgcaggtg
cagaacctggccgagccggccgacccgaacgacccgctgctgcgggaatggagcaaggcg
gaggcgaacccggtgctggtgccgccgccgggcatcgggctgacggacttccgcgacccg
acgacggcgtggcgcaacccggccgactcggcgtggcggatcaccatcgggtccaaggac
cgcgaccacgcggggctggcgctcgtgtacaagacggaggacttcctgcactacgacctg
ctgcccacgctgctgcacgtcgtcaagggcaccggcatgtgggagtgcgtggacttgtac
ccggtgtccacctcgccggccgtcgaggacgggctcgagacgtccaccccgccggggccc
ggcgtgaagcacgtactcaaggccagcctcgacgacgacagaaacgactactacgccatc
ggcacctacgacggcgagaccgatacctggacgccggacaacgccgacatcgacgtcggg
atcgggctccggtacgactacggcaagttctacgcgtccaagacgttctacgaccccgtc
gggcggcgtcgcgtgctatgggggtggatcggcgagaccgacagcgagcgggctgacata
ctcaagggctgggcctcccttcagtcaattccgaggacagttatgctggacacgaagact
ggcagcaacctgctccagtggccggtggtggaggtggagaacctccgtatgcgcggcaag
agcttcgacggcctcgacgtctctcccggctccgtcgtgccgttggacgtcggcaaagca
acacagctggacatcgaggccgtgttcgaggtggacacttcggcagccgacggtgtcgtc
acggaggctggagcagcagcatacagctgcggcacgggcggcggtgcggttggccgtggc
ttgatgggcccgttcgggcttctcgtgctggccgatgatcagttgtcggagcggacggct
gtcttcttctacctggtcaagggagtcgacggcaaccttacaaccttcttctgccaagac
gagctcaggtcatcaaaagcaaacgatctagttaagagagtctatggcagcttggtacct
gtgctagatggcgaaaacctgtcaataaggattttggttgatcactccatagttgagggc
ttcgctcaaggagggaggacatgcattacctcgcgtgtgtatcccaccaaagccatctac
gagtcggccaaaatctttcttttcaacaatgccacaaatgttagagtcactgccaaatcg
ctaaagatttgggagctgaactctgcttacatccgtccatatgtagactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337312
Entry
4337312           CDS       T01015                                 
Name
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 6
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4337312
   00500 Starch and sucrose metabolism
    4337312
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4337312
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4337312
NCBI-ProteinID: XP_015634384
UniProt: Q56UD0
LinkDB
Position
4:complement(33940929..33943794)
AA seq 596 aa
MALAGLPLSVFAIAVHFCLVFSSSSSPPVCPANGHRDRTAYHFQPAKNWQNDPNGPVYYN
GMYHLFYQYNPHGALWDVGNLSWGHSVSGDLVNWAALDNALDPTAPFDANGCASGSVTIL
PDGVPVVMYSGIDARRRQVQNVAFPKNPRDPLLREWTKPGYNPVIPVPADVSPDNFRDPT
TAWLGSDGLWRFAISAVADGVGATLVYRSADFLRWERNAAPLHASRDAVMAECPDLFPVA
EHGEDGLDLDASAIGGAGAGVRHVLKVSMPDTLEDYYMVGRYDDADDTFTVPPEDLEAHG
DDYRRWRRIDHGHLYASKTFYDAGKKRRVLWAWVNESDSEADDVTKGWSGLQSFPRAVWL
DEGGRQLVQWPVEEIETLRRKRGVLLGGNEVEAGGLREIGGIAGSQADVEVAFEIASLAG
ADRLEPDHLRDPDALCGENGAAVHGGIGPFGLLVMASGDLRERTAVFFRVFRLSHGYTVL
MCTDLTRSTSRAGVYKPSHGGFVDIDIEKDRAISLRTLIDHSIVESFGGGGRTCMTARVY
PEHVATGSSHLYVFNNASDAVKVSKLEAWELATASVNAGDDGLISYGGPVCAAQVQ
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcgttggctggattgcccctctccgtctttgccatcgctgtccatttttgccttgtt
ttctcctcctcctcttctcctccggtttgccctgcaaacggccaccgtgaccgaacggcg
taccacttccaacccgccaagaactggcagaacgatccgaatgggcctgtgtactacaat
ggcatgtaccacctcttctaccagtacaacccgcacggcgcgctctgggacgtcggcaac
ctctcctgggggcactccgtctccggcgacctcgtgaactgggccgccctcgacaacgcg
ctcgatcccacagcgccattcgacgccaatggttgcgcgtcggggtcagtcaccatcctc
cccgacggcgtgcccgtcgtcatgtactccggcatcgacgcccgccgccggcaggtccag
aacgtcgcgttccccaagaaccctcgcgacccgctcctccgcgagtggaccaagcccggg
tacaacccggtcatccctgtccccgccgacgtctcgccggacaatttccgggaccccacc
accgcctggctcggcagcgacggcctgtggcggttcgccatctccgccgtggccgacggc
gtgggcgcgacgctcgtgtaccggagcgccgacttcctgcggtgggagcgcaacgcggcg
ccgctgcacgcctcgcgggacgcggtcatggccgagtgccccgacctgttccccgtcgcc
gagcacggcgaggacgggctcgacctcgacgcgtcggcgatcggcggcgccggcgccggc
gtgaggcacgtcctcaaggtcagcatgccggacaccctcgaggactactacatggtcgga
cggtacgacgacgcggacgacacgttcaccgtgccgccggaggacctggaagcccacggc
gatgactaccggcggtggcggcggatcgaccacggccacctgtacgcgtccaagacgttc
tacgacgcgggcaagaaacggcgcgtgctgtgggcgtgggtgaacgagtccgacagcgag
gccgacgacgtcaccaagggctggtccggccttcagtcgtttccgcgggcggtgtggctg
gacgagggcgggaggcagctggtgcagtggccggtggaggagatcgagacgctgaggcgg
aaacgcggcgttctgctcggcggaaacgaggtggaggcgggcgggctgcgcgagatcggc
ggcatcgcgggctcgcaggcggacgtggaggtagcgttcgagatcgcgagcctcgcgggc
gccgaccgcctcgagcccgaccatttgcgtgaccccgacgcgctgtgcggggagaatggc
gcggcggtgcacggcggaatcggcccgttcgggctgctcgtcatggcatccggcgacctg
cgcgagcgcaccgccgttttcttcagggtgttcaggctctcgcacgggtacacggtcctc
atgtgcacggacctgacacggtcaacttcaagagcaggggtgtacaagccatcccacgga
ggattcgtggacatagacatagagaaggacagggctatatcgcttcgaaccctgatcgat
cattcgatcgtggagagttttggcggtggggggcggacgtgcatgacggctcgagtgtac
cctgaacatgtagcaacggggagcagccacctgtacgtgttcaacaatgcgtcagatgcg
gtgaaggtgtccaagctggaggcatgggagctcgcgacggctagtgtcaatgctggagac
gacgggctgatttcgtatggtggtcctgtatgtgctgctcaagtgcagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337313
Entry
4337313           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: beta-fructofuranosidase, insoluble isoenzyme 5-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4337313
   00500 Starch and sucrose metabolism
    4337313
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4337313
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4337313
NCBI-ProteinID: XP_015636828
LinkDB
Position
4:complement(33943983..33946602)
AA seq 558 aa
MCPVNGKLQLHDGRTAYHFQPAKFWQNDPNGPLYHNGLYHFFYQYNPHGPLWDTGKLSWG
HSVSGDLVNWAFLGTAIDPTDPFDVNGCWSGSATVLLGGRPAFLYTGRDAGGVQVQNVSF
AKNPLDPLLREWEKPSCNPIIAFPADVINNNFRDPTTAWLGRDGLWRMVVAAEVAGAGSA
LVYRSADFLRWERNAAPMHSSAAVPVLECPDFFPVAEHGIDGLDTSANGGGTGVKHVLKL
SEFDTHQDFYMVGRYDDEXDTFSPEEPDRGDNCRRWRCLDYGQAYAAKSFFDARRNRRVQ
WLWVNEYDSKADDVAKGWAGVQAFPRKVWLDGDGKQLLQWPVDEIETLRTKRVGLQGTEV
KAGGLHEIVGVASSQADVEVVFEIPNLEDEAESFDPDWLDPHKLCKDKGAASAHGGVGPF
GLIVMASGDLQEQTAVFFRVFKHHGKYKVFMCTDLTRSSTKADVYKDAYGGFVDVDIQKD
KSISLRTLIDHSMIESFGGGGRACITTRVYPEHAATSSSHLYVFNNGSGTVNVSKLEAWE
MATATVNSADALDAITRS
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtgccctgtgaacggaaagctgcagctgcacgatggcagaactgcctaccacttccag
cctgccaagttctggcagaatgatccaaatgggcctctgtaccacaacggtttgtaccat
ttcttctaccagtacaacccgcacggcccgctctgggacaccggcaagctctcctggggc
cactccgtctccggcgacctcgtgaactgggccttcctcggcacggcgatcgaccccacc
gacccgttcgatgtcaacggatgctggtcgggctccgccaccgtcctcctcggcggccgc
cccgccttcctctacaccggcagggacgccggcggcgtgcaggtgcagaacgtgtccttc
gccaagaacccgctcgacccgctcctccgcgagtgggagaagcccagctgcaacccgatc
atcgccttccccgccgacgtcatcaacaacaacttccgcgacccgacgacagcgtggctc
ggccgggatggcctgtggaggatggtcgtcgccgccgaggtcgccggcgccggctccgcc
ctggtgtaccggagcgccgacttcctccgctgggagcggaacgccgcgccgatgcactcg
tcggcggccgtccccgtcctggagtgcccggacttcttcccggtggcggagcacggcatc
gacggcctcgacacgtcggcgaacggcggcggcaccggcgtgaagcacgtgctcaagctc
agcgagttcgacacgcaccaggacttctacatggtggggcggtacgacgacgagngggac
accttctcgccggaggagcctgaccgcggcgacaactgccggagatggcgctgcctcgac
tacggccaggcgtacgccgccaagtcgttcttcgacgcgcgcaggaatcggcgtgtgcag
tggctgtgggtcaacgagtacgacagcaaggccgacgacgtcgccaagggctgggccggc
gtccaggcgttcccgaggaaggtgtggctggacggcgacgggaagcagctgctgcagtgg
cccgtcgacgagatcgagacgctaaggacgaagcgtgtcgggctgcagggcacggaggtg
aaggccggcggcctgcacgagatcgtcggcgtcgcgagctcccaggccgacgtcgaggtg
gtgttcgagatcccgaacctggaggacgaggccgagagcttcgatcccgactggctggat
ccccacaagctgtgcaaggacaagggcgccgcctccgcgcacggcggcgtcggcccgttc
gggctcatcgtcatggcctccggcgacctgcaggagcaaaccgccgtcttcttcagagtg
ttcaaacaccatggaaagtacaaggtcttcatgtgcactgacctcacaaggtcatcgaca
aaagcagatgtgtacaaggacgcttacggaggattcgttgatgtggacatacagaaggac
aagagcatatcactcagaacactgattgaccactcgatgattgagagcttcggaggcggt
ggccgagcgtgcatcacaacccgggtataccctgagcacgcagcaacaagcagcagtcac
ctgtacgtgttcaacaatgggtcaggcacggtgaatgtgtccaagctcgaggcgtgggag
atggccacggcgaccgtgaactctgcagatgcattggacgcaataacgcgtagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346527
Entry
4346527           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: beta-fructofuranosidase, insoluble isoenzyme 7-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4346527
   00500 Starch and sucrose metabolism
    4346527
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4346527
SSDB
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Other DBs
NCBI-GeneID: 4346527
NCBI-ProteinID: XP_015612576
LinkDB
Position
9:4165325..4170978
AA seq 643 aa
MLFSQTHDSGHQPNRRFLQSFRAEAETPTRRRSARSSSPSPPAAAMARLGLAVCAASFHL
FLLLASTSSLRRAPTEADTANHARRTAYHFQPAKNWQNDPNGPMYHNGMYHLFYQYNPHS
ALWDIGNLSWGHSVSGDLLNWAALDTALDPTSPFDANGCWSGSATILPGALPAILYTGID
ASKEQVQNVAFAKNPSDPLLREWEKPAYNPVIALPADVPGDKFRDPSTAWLGRDGLWRIA
VSAEVDGVASTLVYRSKDFVRWERNAAPLHASRAAGMVECPDLFPVAERGEDGLDTSANG
AGGVRHVLKLSVMDTLQDYYMVGTYDDAADAFSPAEPERGDDCRSWRRLDYGHVYASKSF
FDVRKNRRVLWAWANESDSQADDVARGWSGVQTFPRKMWLAKDGKQLLQWPIEEIKTLRR
KRAGLWQGTRLGAGAVQEIVGVASSQADVEVVFKIPSLEEAERVDDPNRLLDPQKLCGEK
GAAVRGGVGPFGLLVMASGDLHEHTAVFFRVFRHHDKYKLLMCTDLTKSSTRAGVYKPAY
GGFVDMDIDDHKTISLRTLIDHSVVESFGGGGRACITARVYPEHVATSSSHLYVFNNGSD
AVKVAKLEAWDLATATVNVVVGDHHGLVAPALELEPXTHDAVI
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcttttttctcagactcatgactcagggcaccaaccaaacaggcgttttcttcagagt
ttcagagcagaagcagagacaccaacaagaaggcgatcagctcgttcttcttctccctct
cctccagcggcggccatggcgagattaggccttgccgtctgcgccgcctccttccacctc
ttccttcttcttgcgtcgacctcctcgctccggcgagctcccacggaggcggacacggcc
aaccatgccagaagaactgcctatcacttccagcctgcaaagaactggcagaatgatccg
aatgggcctatgtaccataacggtatgtaccatttgttctaccagtacaacccgcatagc
gcgctctgggacatcggcaacctctcctggggccactccgtctccggcgacctcctcaac
tgggccgctctcgacaccgcgctcgaccccacctcgcctttcgacgccaatggctgctgg
tcgggctccgccaccatcctccccggcgccctcccggccatcctctacaccggcatcgac
gccagcaaggagcaggtccagaacgtcgccttcgccaagaacccctccgatccgctcctc
cgcgagtgggagaagcccgcgtacaatccggtcatcgcgctcccggccgatgtccccggc
gacaagttccgtgacccctcgacggcatggctcggccgtgacggcctgtggcggatcgcc
gtctccgccgaggtggacggcgtcgcgtccacgctcgtctacaggagcaaggacttcgtc
cggtgggagcggaacgccgcgccgctgcacgcgtcgcgcgccgcgggcatggtggagtgc
ccggacctgttccccgtagcggagcgcggcgaggatggcctcgacacgtcggcgaacggc
gccggcggcgtgcgccacgtcctgaagctgagcgtgatggacacgctccaggactactac
atggtcggcacgtacgacgacgcggcagacgccttctcgccggcggagcctgagcgcggc
gacgactgccggagctggcggcggctggactacgggcacgtgtacgcgtccaagtcgttc
ttcgacgtgcgcaagaaccggcgcgttctgtgggcgtgggcgaacgagtccgacagccag
gccgacgacgtcgcccgcggctggtccggcgtgcagacattcccgaggaagatgtggcta
gccaaggacggcaagcagctgctgcagtggccgatcgaggagatcaagacgctgaggagg
aagcgcgccggtctctggcaaggcaccaggctaggcgccggcgcggtgcaggagatcgtc
ggcgtggcgagctcgcaggcggacgtggaggtggtgttcaagattccgagcctggaggag
gccgagagggtggacgaccccaaccggctgctggatccccagaagctgtgcggtgagaag
ggcgccgccgtgcggggcggcgtcggcccgttcgggctcctcgtaatggcctccggcgac
ctgcacgagcacaccgccgtcttcttcagggtgttcaggcaccatgacaagtacaagctt
cttatgtgcaccgacttgacaaagtcgtcgacaagagcaggggtgtacaagccggcttac
ggcggattcgtggacatggacatcgacgatcacaaaaccatatcgctgagaacgttgatt
gaccattcggtggtggagagcttcggcggcggcgggcgggcgtgcatcacggcgcgggtt
tacccggagcacgtggcgacgagcagcagccatttgtacgtgttcaacaacgggagcgac
gccgttaaggtggccaagctggaggcgtgggacctggcgacggcgaccgtcaacgttgtt
gttggagaccaccacggccttgttgcgccggcgttggagttggagccgnacacgcacgac
gcagtgatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268563
Entry
9268563           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC9268563 isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    9268563
   00500 Starch and sucrose metabolism
    9268563
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     9268563
SSDB
Motif
Pfam: DUF5052
Other DBs
NCBI-GeneID: 9268563
NCBI-ProteinID: XP_015612574
LinkDB
Position
9:4190748..4194670
AA seq 346 aa
MAEELLITSSLQRTGRMIRMMDRLVRLHYGGSVVEQSNSGSNFEGMSVKQLIFGGKPSFE
ELVCHTKDVLGWSNQSIAIQGRYDVGAGPISHKYMLDLNGELEWNTYVDIVLGSQFKSLE
VVASKLDRTDCRDNSFDLNRTLFYDEPNYEAFDDEGAMKSQSVKSLTVEEVIESQGMGVD
VNMQKKEAVDANEGRSQESERVEINVELQKEEAVEANKASRLESEGVEVNVELQKEEAIE
VNEARSQAVPIVGNHVDDDNELADGSMGAGGEERTTDAQLASMVRFYFQDKIYTRRECEE
TLLMNGLSVDLLHKHSEEYDDTHEEEGYEVEYAVDLDDDRPVAKMS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcagaagaactgcttatcacttccagcctgcaaagaactggcagaatgatccgaatg
atggatagattagtacgattgcactatggtggttcggtggtagagcaaagtaacagtggt
agcaatttcgaggggatgagtgttaagcaacttatatttggtggaaaacctagttttgag
gagttagtttgtcatacaaaggatgtgctggggtggagcaatcagtctatagctatacaa
ggtagatatgatgttggagcaggacccatttcacacaagtacatgctagatttgaatggg
gagttggagtggaacacatatgtggatatagtgttgggctcccaattcaagtcgcttgag
gtggttgcttcgaagcttgatcgtactgactgcagagataattcttttgacctcaatcgc
acactgttttatgatgaaccaaactatgaagcatttgatgatgaaggagctatgaaaagt
cagtcggttaagtctttgacagttgaggaagtcatagaatctcaagggatgggggtggat
gttaacatgcaaaagaaggaagcagttgatgcgaatgagggaaggagtcaggaatctgaa
agggtggagataaatgtggagttgcagaaggaggaagcagttgaggctaataaggcaagc
aggcttgaatcagaaggcgtggaggtaaatgtggaattgcagaaggaggaagcaatagag
gtgaatgaggcaaggagtcaggcagttccgatagttggaaatcatgttgatgatgataat
gaattggcagatggatcaatgggggcaggtggagaagagcgtacaacggatgctcaatta
gcatccatggtgcggttctattttcaagacaaaatatatactcggagggagtgtgaggag
actttgttgatgaatggattgagtgttgatttgctgcacaaacattcagaggagtatgat
gacacacatgaggaggagggatatgaggttgagtatgccgtagacttagatgacgatcgt
ccagtagccaagatgtcttag

DBGET integrated database retrieval system