KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329580
Entry
4329580           CDS       T01015                                 
Name
(RefSeq) threonine--tRNA ligase, chloroplastic/mitochondrial 2
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4329580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4329580
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4329580
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     4329580
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4329580
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4329580
 Prokaryotic type
    4329580
SSDB
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD
Other DBs
NCBI-GeneID: 4329580
NCBI-ProteinID: XP_015625570
UniProt: B9F0E6 Q6ER90
LinkDB
Position
2:complement(19924404..19928334)
AA seq 674 aa
MAAAVSAPLLRFHHHHRCLLRHSSSPRRYPAGFSRGLSSVSFGLPRSTTTAARSTASPSA
PSAAAAEATDAASAQAGSDGKGDGIGEEERVVLPTNESSDRLLRIRHTCAHVMAMAVQKL
FPNSKVTIGPWIDNGFYYDFDMEPLTDKDLKRIKKEMDRIIRKNLPLVREEVSREEAQKR
IEALNEPYKLEILEGIKEDPITIYHIGEEWWDLCAGPHVESTGKIDRRAVELESVAGAYW
RGDESNQMLQRIYGTAWETEDQLKAYIHFKEEAKRRDHRRLGLDLDLFSIQEDAGGGLVF
WHPKGAIIRHVLEDSWKQIHLQRGYDLLYTPHVAKAELWKVSGHIDFYKENMYNQMDVED
ELYQLRPMNCPYHILVYKRKLHSYRDFPIRVAELGTVYRYELSGSLHGLFRVRGFTQDDA
HIFCLEDQIKDEIRGVLDLTEQILGQFGFRYYEINLSTRPEKSVGSDDIWEKATLALKDA
LEDKGWEYKVDEGGGAFYGPKIDLKIEDALGRKWQCSTVQVDFNLPERFDITYVNSNSEK
KRPIMIHRAILGSLERFFGVLIEHYAGDFPLWLAPIQARILPVTDNELQYCNEVASELKS
KGIRAEVCHGERLPKLIRNAETKKVPLMAVVGPKEVQARTLTIRSRHSGEIGTMPVDEFF
RRIQLAIANKSSSL
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggcggccgccgtctccgcgccccttctccggttccaccaccaccaccgctgcctcctc
cgccactcctcctcgccgcgccgctacccagccggcttctcgcgtgggctcagctccgtc
tcgttcggcctcccgcgcagcaccaccaccgccgcgcgctccaccgcctcgccctcggcg
ccgtcggcggcggcggccgaggccacggatgcggcttccgcccaggcgggatccgacggc
aagggggatgggattggggaggaggagcgcgtcgtgctccccaccaacgagtcctccgac
cgcctgctccgcatccgccacacctgtgcgcatgtgatggccatggccgtccagaagctg
ttccccaactccaaggtgacaataggtccctggatagacaacggcttctactacgacttc
gacatggagcccctcacggacaaggacctcaagaggatcaagaaagagatggatcggatc
atccggaagaatctcccattggtgagggaggaggtgtccagggaagaggcccaaaagagg
attgaagcgcttaatgagccatataagttggaaattttggagggcatcaaggaagatcct
atcacaatctatcacattggagaagagtggtgggatctctgtgccggacctcatgtcgag
tctactggcaaaatcgatagaagagctgttgagcttgagtctgttgctggtgcttactgg
agaggtgacgaaagtaatcaaatgctacaaagaatatacgggactgcatgggagactgaa
gaccaattgaaggcttacatccacttcaaggaagaggccaagcgccgtgatcatcggcga
ttaggtctggatcttgatctattctccatacaggaagatgctggtggcggtttagtattc
tggcatccaaaaggtgctattatcagacatgttttagaagactcatggaaacagattcac
ttgcaacgtggttatgatctattatacactccccacgttgcaaaggctgaactttggaag
gttagtgggcatatcgatttctacaaagagaacatgtacaatcaaatggatgttgaagat
gagctatatcaacttcggcccatgaattgcccttaccacattttagtatacaagagaaag
ctacattcatacagggattttcccattcgagtggcagagcttggaactgtctacagatat
gagctatctggtagtttgcatgggctgttccgtgtcagaggatttacgcaggatgatgcc
cacatattttgtctggaggaccagataaaagatgaaattagaggtgttcttgatctgact
gagcaaatactgggccaatttggctttcggtattatgagataaacctttcaacaaggcca
gaaaaatctgttggcagtgatgacatatgggaaaaagcaacacttgcactaaaagatgca
ctagaagacaaaggttgggagtacaaggttgatgaaggtggaggcgctttctatggccca
aaaattgatttgaaaattgaggatgctcttggaagaaaatggcaatgttccactgtgcag
gtcgatttcaatttacctgagcggtttgacattacttatgtcaattcaaatagcgagaag
aaacggcctatcatgattcatagagctatccttgggtctttggaacgattttttggtgtc
ctcattgaacactatgctggtgattttccactttggcttgcaccaatccaagctcgtatt
ctacctgtgacagacaatgagctgcaatactgtaacgaggtggcttcagaactgaaatca
aaaggcattcgagctgaggtatgtcatggcgagcgtctaccaaagctaatacggaatgcc
gaaacgaagaaagtgccgctcatggcggtcgttgggcctaaagaagttcaagccaggacc
ctcactatcaggtccaggcatagtggggagattggtactatgcctgtggatgaattcttt
cgcagaatccaacttgctattgcgaacaaatcttcttcactatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345200
Entry
4345200           CDS       T01015                                 
Name
(RefSeq) threonine--tRNA ligase, mitochondrial 1
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4345200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4345200
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4345200
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     4345200
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4345200
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4345200
 Prokaryotic type
    4345200
SSDB
Motif
Pfam: tRNA-synt_2b HGTP_anticodon TGS tRNA_SAD
Other DBs
NCBI-GeneID: 4345200
NCBI-ProteinID: XP_015650707
UniProt: A0A0P0XE22 Q6Z0N5
LinkDB
Position
8:complement(11887867..11897477)
AA seq 745 aa
MLVCLRRRGLSLLRQRPPRPFPPLPRPRSSPPRVASLRPLSAAAMGENSAAAAGKGKEAK
GKATTSASASAPNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAV
KDGKKWISTPMDIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDT
FWHSSAHILGESLERAYGCKLCIGPCTTRGEGFYYDAYYNDLTLNETHFGIIDAQAQKAV
AEKQPFERIEVSRAEALEMFAENKFKVEIINELPEDKTITVYRCGPLVDLCRGPHIPNTS
FVKAFACLKASSSYWRGKADRESLQRVYGISFPDSKRLKEYKHLLEEAKKRDHRLLGQTQ
DLFFFHQLSPGSCFFLPHGAIIYNKLMDFLRQQYRDRGYQEVLSPNIYNMQLWETSGHAA
NYKENMFVFEIEKQEFGLKPMNCPGHCLMFEHRVRSYRELPLRMADFGVLHRNELSGALT
GLTRVRRFQQDDAHIFCRESQIKDEVKAVLDFINYVYEIFGFKYELELSTRPEKYLGDIE
TWNKAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLR
FKLTYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNS
VEYAKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVR
DKAELATVSIDDIITRFKEEVAAYK
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgctcgtctgcctccggcgacgaggcctctcgctcctccggcagcgcccgccccgcccc
ttcccccctctcccgcgcccgcgcagcagcccaccccgcgtcgcctccctccgccccctc
tccgccgcggcgatgggggagaactccgccgccgccgccgggaaggggaaggaagcgaag
gggaaggcgacgacctcggcctcggcctcggcaccgaacgtcgagcccgacgtggcctac
cttgaggcggtgacgcagaagcggatccggcagttcgaggagatccaggccaagcaggcc
ctcgagcgcctcaacatcggaggcgagcccatcaggataactttgccagatggtgcagtc
aaggacggaaagaaatggatctcaacccctatggatattgctaaggagatatcaagtgga
ttagcaaatagctgcttgatagctcaagtgaatggaacactgtgggatatgacgaggcca
ctggaaggtgattgtgaattgaagttgttcaagtttgatagcaatgaagggcgtgacacc
ttctggcactcaagtgctcatattcttggagaatctcttgagagggcatatggctgcaag
ctgtgtattgggccatgtactacaagaggggagggtttctattatgatgcctactacaat
gatctgacattgaatgagacacattttggtatcattgatgcccaagcacagaaagctgtt
gcggaaaaacaaccatttgaacgaattgaggtctccagggcagaggcccttgaaatgttc
gcagaaaataaatttaaggttgaaatcattaatgagttgcctgaagacaagaccattaca
gtatacagatgtggtcctctagttgacctttgccgtgggccacacatccccaatacttcc
tttgttaaagcttttgcttgtcttaaggcatcatcgtcgtattggagagggaaagcagat
cgagagagcctgcagagagtatatggaatttcttttcctgattctaaacgtctcaaggaa
tataaacatctgctagaagaggctaagaagcgtgatcataggctattaggacagacccag
gatctcttctttttccatcaacttagtccaggaagctgcttcttccttccacatggtgct
ataatatacaacaaattgatggattttttgcgacagcaatacagagatagaggatatcaa
gaggttttgagcccaaatatttacaatatgcaactctgggaaacctctggacatgctgca
aactacaaggagaatatgtttgtttttgagattgagaaacaggaatttggtctcaagcca
atgaattgtcctggccattgcctaatgtttgagcacagggttcgttcatacagagaattg
cctctccggatggctgattttggagtccttcacaggaatgagcttagtggtgcacttaca
ggtttgacacgtgttagaagattccagcaggatgatgcccatattttttgcagagaaagc
caaatcaaggacgaagttaaggctgttttggacttcatcaattatgtttacgagatattt
ggatttaaatatgaattggagctatcaacgagaccagaaaagtacttaggtgatattgaa
acctggaacaaagcagagcaacagctgacagaagccttaaatgagtttggaaagccatgg
cagatcaatgaaggtgatggtgccttctatggtccaaaaattgatattggtgtgtttgat
gccctcaagaggaaatttcagtgtgcaactctacagctcgattttcagctgcccctacgc
ttcaagctgacttactctgcagaggatgaagccaaacttgagaggcctgtgatgattcac
agggcaatcctaggttctgttgaaaggatgtttgctattcttttggagcattacaatggt
aaatggcccttgtggttgagtcctcgccaagccattgtttgctccatatcttccaattca
gtggaatacgctaaacaggtccgtgctaggatacatgaagctggttttcatgtagccatc
gatgagacagacaggacaatacagaagaaggtacgggaggctcaattagcccaattcaac
tacattcttgtcgttggtgcacaagaagcagagactggacaggtcagcgtcagggtaagg
gacaaagctgaactagccacagtgagcattgatgacatcatcacacgttttaaggaggaa
gtagcagcttacaaatga

DBGET integrated database retrieval system