KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329584
Entry
4329584           CDS       T01015                                 
Name
(RefSeq) digalactosyldiacylglycerol synthase 1, chloroplastic
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4329584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329584
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     4329584
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4329584
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4329584
NCBI-ProteinID: XP_015626791
UniProt: Q6ER83 A0A0P0VK37
LinkDB
Position
2:19973168..19977429
AA seq 802 aa
MEARASPSPSPQRPASMGRGGGGGGGGGDASAALSFIYKGWREVRDSASADLRLMRARAD
SLRTLADRELEHLLVSASTTVAAPAPPVAAGAPIAEVEFVRNRIQPKISELRRQYAASGD
WELGLGRRVLEGWVAPPPPRGATTARVDLSGITAIRNALVPEVAGGGGASTAWWSGDEME
EEEEKEWEVVRMIRGGLKELERRSQSSGEILGGIPGPSELVEKFKSRLKSFNMEPLGSKE
VPPLDLTEIMANLVRQSGPFLDQLGLRRELRDKLVETLYSRQNHSLSADSSLLGDDNSTD
ELDLRIASVLQSTGYHTDDGLWNEPSKYEVSDNKRHVAIVTTASLPWMTGTAVNPLFRAA
YLARNSKQDVTLVVPWLCKSDQELVYPNSMTFSSPEEQETYIKKWLEERLGFESNFKISF
YPGKFSKERRSIIPAGDTSQFISSREADIAILEEPEHLNWYHHGNRWTDKFNHVVGVVHT
NYLEYIKREKNGALQAFLVKHINNWVTRAYCDKVLRLSAATQDLPKSIICNVHGVNPKFL
KIGDKIMADRENGQQSFSKGAYFLGKMVWAKGYRELLDLLDKRKSDLQGFKLDVYGSGED
SQEVQSTAKKLNLNLNFFKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVICA
EHPSNEFFMSFPNCLTYRTPEEFVARVNEAMAREPQPLTPEQRYNLSWEAATERFMEYSD
LDKVLSQPVTEGVHRSKTRRTIQSNLSDAMDGGLAFAHHCLTGSEVLRLATGAIPGTRDY
DKQHCVDMGLLPPQVQHPVYGW
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggaggcgagggcgtcgccgtctccgtcgccgcagcggcctgcgtcgatgggtagaggc
ggcggaggaggcggaggaggaggggacgcgagcgcggcgctgtcgttcatctacaagggg
tggagggaggtgcgggactcggcgagcgcggacctgcggctgatgcgtgcgcgggcggac
tcgctgcgcacgctcgccgaccgggagctggagcacctcctggtgtcggcgtccaccacg
gtggcggcgcccgcgccgcccgtcgcggcgggggcgcccatcgcggaggtggagttcgtg
cgcaaccggatccagcccaagatctccgagctgcggcgccagtacgcggcgtccggggac
tgggagctcggcctcggcaggagggtgctcgagggctgggtggcgcctccgccgcccagg
ggcgccaccaccgcccgcgtcgacctctccgggatcaccgccatacgcaacgccctcgtc
cctgaggtcgccggcggcggcggggcgagcaccgcctggtggagcggggatgagatggag
gaggaggaggagaaggagtgggaggtggtgaggatgattcgcggcggcctcaaggaattg
gagcgccgcagccagagcagcggcgagatcttggggggaatccctggccccagcgagctc
gtcgagaaattcaagtccagactgaaatcatttaacatggagcctcttggatccaaggaa
gttcctcctcttgatctgactgaaattatggcaaatctagttaggcaatctgggcccttt
ttggatcaacttggtctaaggagagaactacgtgacaaactagtggagacattgtatagc
agacaaaatcattccctttcagcagattcatccttactcggagatgataactcaacggat
gagcttgatttaagaattgctagtgtgctacaaagtactggttatcatacagatgatggt
ttatggaacgaaccttcaaaatacgaggtttcagacaataaaaggcatgttgcaatagtc
accacagcaagcctaccatggatgacaggaacagcagttaatccattgttccgggcagca
tatttggcaagaaactcaaaacaggatgtcacactggtggtgccttggctttgcaagtca
gatcaagaacttgtgtatccaaatagcatgaccttcagttcaccagaagagcaggaaaca
tatataaagaagtggctggaggaaaggcttgggtttgaatcaaacttcaagatatcattt
tatcctggcaagttctccaaagagcgccgtagcatcattcctgctggggatacatcacag
ttcatttcatcgagagaagctgatatagcaatattggaagaaccagagcatctgaactgg
tatcatcatgggaatcgttggactgacaagttcaatcatgtagttggcgtagttcatacg
aattacctagaatatatcaagagagagaagaatggtgctcttcaagctttcctggtcaaa
cacatcaacaattgggtgaccagagcatactgcgataaggttttacgtctgtctgcagca
actcaggatcttcctaagtctattatttgcaacgtccatggtgtaaatccaaagttcctt
aagattggagataaaataatggccgatagggagaatgggcagcaatcattttccaaggga
gcatattttctgggcaaaatggtatgggccaaaggttaccgggaactgttagatttgttg
gataaacgtaaaagcgacttgcaaggattcaagttggatgtatatggaagtggcgaggac
tcacaagaagtccaatctaccgccaagaaactgaacctgaatctaaacttttttaaggga
agggaccatgcagatgactcactccatgggtacaaggtattcatcaacccgagcatcagt
gatgtcctgtgcacagcaacagcggaagctctcgcgatggggaagttcgtcatctgcgcg
gagcatccatcgaacgagttcttcatgtcgttcccgaactgcctgacgtacaggaccccg
gaggagttcgtcgccagggtgaacgaggccatggccagggaaccccagcctctcaccccg
gagcaaaggtacaacctgtcgtgggaggcagcaaccgagaggttcatggagtactcagac
ctcgacaaggttctcagccaacctgttacagaaggcgtgcacagaagcaagacgagaaga
acaattcagagtaatctgtcggacgccatggatggaggattggcgtttgctcaccactgc
ctaactggtagcgaggttctcaggctggcaacgggagcgattcctggtacgcgcgactac
gacaagcaacactgcgtggacatgggcctcctgccgcctcaagtgcagcaccctgtatat
ggttggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332054
Entry
4332054           CDS       T01015                                 
Name
(RefSeq) digalactosyldiacylglycerol synthase 2, chloroplastic
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4332054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332054
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     4332054
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4332054
SSDB
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1
Other DBs
NCBI-GeneID: 4332054
NCBI-ProteinID: XP_015630517
UniProt: Q10Q06 B9F665
LinkDB
Position
3:complement(5994073..5997767)
AA seq 476 aa
MSTRRHLAVFTTASLPWMTGTAINPLFRAAYLAKDGDREVTLVIPWLSLRDQELVYPNKI
VFGSPLEHEAYVRRWIEERISFRPSFSIKFYPAKFSKELRSILPVGDITECIPDEVADVA
VLEEPEHLNWYHHGRKWKNKFRRVIGVVHTNYIAYVKREKNGQAIACFMKYMNTWVTRIY
CHKIIRLSGATQDLPRSVVCNVHGVNPKFLEVGKLKLKQLRNGEIAFTKGAYYIGKMVWS
KGYRELLDLLSKYQSKLVGLEVDLYGSGEDSDEVRKSAELLSLAVKVHPGRDHADPLFHD
YKVFINPSTTDVVCTTTAEALAMGKIVICANHPSNEFFKQFPNCRTYDSGEEFVQLTLDA
LAEQPAPLTDMQSHDLSWEAATERFMEAAELNLPISAEPRIHQTSKVSLPAFMRTRKLKQ
SLEDASVYLHQALSGLEVTRRAFGAVPKTLQPDEQLCNDLGLAPAKKKRLKLKLMT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtcgacaaggcgtcatcttgcagtatttaccactgcaagcctcccatggatgacagga
acggccatcaacccgttgttccgggcggcctatcttgcaaaggatggggatagggaggtc
accttggtaatcccctggctttctctgagggaccaagaattggtttacccgaataagatt
gtgttcggttcgcctttggagcatgaggcctatgttcgtcgctggattgaggagaggatc
agtttcagaccttccttcagcatcaaattctaccctgcgaagttctctaaagaactgaga
agtattctacctgttggagatatcacagaatgtattccagatgaagtggctgatgttgct
gttctggaagaacctgaacatctcaattggtaccaccatgggcgcaaatggaaaaataag
ttcaggcgagtgataggtgtggttcacacaaattatatagcatatgtgaaaagagaaaag
aatggacaagcgattgcctgtttcatgaagtacatgaacacctgggttacccggatttat
tgccacaagattatcagattgtcaggtgccacccaagatcttcccagatctgttgtgtgc
aatgtccatggcgtgaatccaaaatttcttgaggtaggtaaactaaagttgaagcagctg
cggaatggggaaatagccttcacaaaaggggcatactatattgggaagatggtgtggagt
aaaggatacagggaacttcttgacctgctgtccaaatatcagagcaagttggtgggtttg
gaagtagatttatatggtagcggagaagattccgacgaagttcgaaaatctgcagaactt
ctgagtttggccgtgaaggttcacccaggacgtgatcatgcagatcccctgttccatgac
tataaagtattcatcaaccctagcacaacagatgtggtctgtacaacaactgccgaggcc
cttgcaatgggaaagattgtcatatgtgccaatcacccttcaaacgagttcttcaagcag
ttccctaattgccgcacctatgacagtggcgaggaatttgtacaactaacgctggatgct
ctagcagagcagcctgctccactgactgacatgcagagtcatgacctatcttgggaggcc
gcgaccgagagattcatggaagccgcggagctgaaccttcctatctcagcagagccaaga
atccatcaaacatccaaggtctctctccctgcttttatgaggactcgtaaactgaaacag
agcttggaggatgcatcagtttacctgcatcaagcactctcaggacttgaagtcacccgt
cgcgccttcggtgctgttccgaagacgctgcaacctgatgagcagctgtgcaacgatcta
ggtttggctcccgccaagaaaaagaggttgaaattgaagctgatgacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332372
Entry
4332372           CDS       T01015                                 
Name
(RefSeq) digalactosyldiacylglycerol synthase 2, chloroplastic
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4332372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332372
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     4332372
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4332372
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 4332372
NCBI-ProteinID: XP_015630202
UniProt: Q0DT52 Q84JT4
LinkDB
Position
3:complement(8902755..8906387)
AA seq 463 aa
MARKQHIAIFTTASLPWMTGTAVNPLFRAAYLAKAGDWEVTLVVPWLSKGDQLLVYPNKM
KFSVPGEQEGYVRRWLEERIGLLPKFEIKFYPGKFSTEKRSILPAGDITQTVSDDKADIA
VLEEPEHLTWYHHGRRWKNKFRKVIGVVHTNYLEYVKRERNGYIHAFLLKHINSWVTDIY
CHKVIRLSAATQEVPRSIVCNVHGVNPKFIEIGKLKHQQISQREQAFFKGAYYIGKMVWS
KGYTELLQLLQKHQKELSGLKMELYGSGEDSDEVKASAEKLNLDVRVYPGRDHGDSIFHD
YKVFINPSTTDVVCTTTAEALAMGKIVICANHPSNEFFKRFPNCHMYNTEKEFVRLTMKA
LAEEPIPLSEELRHELSWEAATERFVRVADIAPIMSIKQHSPSPQYFMYISPDELKKNME
EASAFFHNAISGFETARCVFGAIPNTLQPDEQQCKELGWRLQE
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcgaggaagcagcatatcgccatattcaccacggcgagcctgccatggatgactgga
actgccgtcaaccccctcttccgagcggcctacctcgcgaaggccggggactgggaggtt
acgctggtggttccatggctttcgaagggggaccagctgctggtttatcctaacaagatg
aaattcagtgtgcccggggagcaagaaggctatgtgcgacggtggctcgaggagcgaatt
gggctgctgccgaagtttgagataaaattctatcctggaaagttctcaacggagaaaaga
agcattctacctgctggggacatcacccagactgtatctgatgataaagcagacattgca
gttcttgaagagccagagcatcttacatggtaccatcatggacgaaggtggaaaaacaaa
ttcagaaaagttataggtgttgttcataccaactatttggagtatgtcaagagagagaga
aatggatatatccatgcatttctcttaaaacatatcaattcctgggtcactgacatctac
tgccataaggttataagattatcagcagcaactcaggaagtcccaaggtcaatagtttgc
aatgtccatggagtaaatccaaaatttattgaaattggtaaactgaagcatcagcagata
tctcaaagagaacaagcattcttcaagggtgcatattatattggaaagatggtctggagt
aaaggttatacagaactactccagctgcttcagaagcaccagaaggaattatctggtctt
aagatggagctgtatggcagtggagaagattctgatgaggttaaagcatcagccgagaaa
ctaaatcttgatgttcgagtctatcctggtcgtgaccatggagattccatatttcatgac
tacaaggttttcataaacccaagcaccacagatgtggtatgcacgacaactgcagaagct
ttggcgatggggaaaattgtgatatgtgcaaaccatccttcgaatgaattcttcaaaagg
tttcctaactgccacatgtacaatactgagaaagagtttgtgagattgactatgaaagca
ttggctgaagagccaatcccactgtcagaggaactgagacatgagctttcctgggaggca
gcaacagagagatttgtcagggttgctgatattgcaccaatcatgtctatcaagcagcat
tctccctctccccagtatttcatgtatatatctccagatgaactgaagaagaacatggag
gaggcgtcggcattttttcataatgcgatttctgggtttgaaacggcccgttgtgttttt
ggtgccataccgaatactctgcagcctgatgaacagcaatgcaaggaacttggctggagg
ctccaggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335812
Entry
4335812           CDS       T01015                                 
Name
(RefSeq) digalactosyldiacylglycerol synthase 1, chloroplastic
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4335812
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4335812
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     4335812
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4335812
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Pribosyltran_N
Other DBs
NCBI-GeneID: 4335812
NCBI-ProteinID: XP_015633561
UniProt: A3ATR6
LinkDB
Position
4:20587007..20593977
AA seq 775 aa
MGGERPPPISGGGAFAFISKGWREVRDSASADLRQMRARADRELEHLLASASALAGPPLP
PVAAGAPIAEVEFVRKRIQPKIMELRRQYSSTVRDAGWAPKAAGASLRVDLSGITAIRNA
IVAEGGGGGGGGGRWGLVRWKGHADDEGRKEWEVVRMIRSGLKEFERRSLSSEVFGGFRG
RGEFVEKFKLSLKSLNKESQESKEVLPLDLTEILAYLVRQSGPFLDQLGIRRDLCDKIVE
TLYSKHNGRLIYHSLSADRSLIGNENMTDELDLRIARVLESTGHHTEESFWKDHAKYKLS
DNRRHVAIVTTASLPWMTGTAINPLFRAAYLARSTKQKVTLVVPWLCKSDQELVYPNNIT
FSSPEEQENYIRNWLQERLGFEANFKISFYPGKFSKERRSIIPAGDTSQFISSSEADIAI
LEEPEHLNWYHHGKRWTDKFKHVIGVVHTNYLEYIKREKNGALQAFLVKHINNWVTRAYC
HKVLRLSAATQDLPRSVVCNVHGVNPKFLKVGEKIAADKEHGQQSFTKGAYFLGKMVWAK
GYRELIDLLSKHKSDLEGFNVDVYGNGEDSQAVQMAARKLNLSLNFFKGRDHADSSLHGY
KVFINPSVSDVLCTATAEALAMGKFVICADHPSNEFFKSFPNCLTYKTSEEFVARVKEAM
ASEPSPLTPEQRYSLSWEAATERFMEYSELDKVLNNKIGYSGQDGKRSKVRKIPLLPRLS
EVVDGGLAFAHHCLTGNEILRLATGAIPGTRDYDKQQCMDLNLLPPQVQHPVYGW
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgggcggagagaggccgccgccgatcagcggcggcggcgccttcgcgttcatctccaag
gggtggcgcgaggtgcgggactcggcgagtgccgacctgaggcagatgcgggcgcgcgcc
gaccgggagctggagcacctcctcgcgtcggcgtcggcgctcgcgggcccgccgctgccg
ccggtcgcggcgggggcgcccatcgcggaggtggagttcgtgcggaagcggatccagccc
aagatcatggagctgcggaggcagtactcgtcgacggtgcgcgacgcggggtgggccccc
aaggccgccggggccagcctccgcgtcgacctctcggggattacggcgatccgcaacgcc
attgtggccgaggggggcggcggcggcggcggcggcgggaggtgggggctcgtgcggtgg
aagggccacgcggacgacgaggggaggaaggagtgggaggtggtgaggatgatacgcagc
gggctgaaggagttcgagcgccggagcttgtcgagtgaggtgtttggtggatttcgtggc
cgcggcgagttcgtggagaaattcaagttgagcttgaaatctctgaacaaagagtcacaa
gaatccaaggaggttctcccactggatcttactgaaattctggcatatcttgtgcggcaa
tctggaccatttctggaccaacttggtattagaagagatttatgtgacaaaattgtggag
acattgtacagtaaacacaatggccggctcatttatcattctctttcagctgatagatct
ttaattggaaatgagaacatgactgatgagcttgatctgagaatagcaagggtgctagaa
agtactgggcatcacacagaggaaagtttttggaaggatcatgcaaagtacaagctctcg
gacaaccggcggcatgttgcaattgtcacaacagcaagtcttccatggatgactgggaca
gcaatcaatccattattccgtgctgcgtatctagcaagaagtacaaaacagaaggtgaca
ctggtggttccttggctctgtaagtcagatcaagagctagtttaccccaataatatcacc
ttcagttcaccagaagaacaagaaaattacataaggaactggctacaggaaagacttggc
tttgaagcaaattttaagatatcattttatcctggcaagttttcgaaggagcgacgtagt
attattcctgctggagatacttcacaattcatttcctcgagtgaagctgatatagcaatt
ttggaagaaccagagcatctcaactggtatcatcatggaaagcgttggaccgacaagttt
aaacatgtcattggtgtagttcacacaaattacctagagtatatcaagagagagaagaat
ggagctcttcaagctttccttgttaagcatatcaacaactgggtgactagagcatactgt
cataaggttttacgtctttctgcagcaactcaagatctacctaggtctgttgtctgcaac
gttcatggtgtaaatccaaagttcctcaaggttggtgaaaaaatagcagctgataaggag
catgggcagcagagctttacaaagggagcatatttccttgggaagatggtttgggctaaa
ggatatagagaacttatagatttgttatccaaacacaaaagtgacttggagggctttaat
gtagatgtatatgggaatggtgaggactcacaagcagtgcagatggctgctaggaaattg
aatttgagcctcaattttttcaaaggaagggaccatgcagattcttcgcttcatgggtat
aaggttttcattaatccaagtgtcagtgatgttctatgcacagcgacagctgaggctctt
gcaatggggaaatttgttatctgtgcagatcatccatcaaacgaatttttcaagtcattc
cccaactgcttaacatacaaaacttccgaagaatttgttgcccgagtgaaagaggccatg
gctagtgaaccttcacctttgacccctgagcaaaggtacagtttgtcatgggaggcagca
actgaaagattcatggagtactcagagcttgacaaagttctgaataacaaaattggttat
tctggacaagatgggaagagaagtaaagtgagaaagatacctttacttcctagactttca
gaagttgtggatgggggactggcctttgctcatcactgcttaactggcaatgagatcctc
agattggcgacaggagcaattcccggtacacgtgactatgataaacagcaatgcatggat
ttgaatttattgcctccccaagttcaacaccctgtatatggctggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349835
Entry
4349835           CDS       T01015                                 
Name
(RefSeq) digalactosyldiacylglycerol synthase 1, chloroplastic
  KO
K09480  digalactosyldiacylglycerol synthase [EC:2.4.1.241]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4349835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4349835
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.241  digalactosyldiacylglycerol synthase
     4349835
Glycosyltransferases [BR:osa01003]
 Glycan extension
  Glycolipid
   4349835
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4349835
NCBI-ProteinID: XP_015617247
UniProt: Q2RAB0 Q0IUG4
LinkDB
Position
11:2817606..2822370
AA seq 736 aa
MASYGVDTRPAAAAAGGGGAGAGAAGEGALSFLSRGLREDLRLIRARAGELETFLTAPVP
EPELLARLRRAYSSSAGTTRLDLSAIGKAFGTGVVGRGSRGARWGWEEVQEAEEWEPIRM
VKARLREMERRRQWQATDMLHKVKLSLKSMSFVPEASEEVPPLDLGELLAYFLKQSGPLF
DQLGIKRDVCDKLVESLCSKRKDHLAYNSFPASEPSAFSNDNAGDELDLRIASVVQSTGH
NYEGGFWNDGHKYETADKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKSSKQDVTLVVPW
LCKSDQELVYPNSMTFSSPQEQEAYMRSWLEERVGFKTDFKISFYPGKFQKERRSIIPAG
DTSQFIPSKEADIAILEEPEHLNWYHHGKRWTDKFNHVVGVVHTNYLEYIKREKNGVIQA
FFVKHINNLVARAYCHKVLRLSGATQDLPKSMICNVHGVNPKFLEVGERIAAERESGQHS
FSKGAYFLGKMVWAKGYRELIDLYAKHKSDLEGIKLDIYGNGEDSHEVQSAAMKLNLNLN
FHKGRDHADDSLHGYKVFINPSISDVLCTATAEALAMGKFVVCADHPSNDFFRSFPNCLT
YKTSEDFVAKVKEAMARDPQPLTPEQRYNLSWEAATQRFMEHSELDKVLSSSNRDCTTST
SGCGKSGDNKMEKSASLPNMSDMVDGGLAFAHYCFTGNELLRLSTGAIPGTLNYNKQHSL
DLHLLPPQVQNPVYGW
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggccagctacggcgtcgacacgcggccggcggccgcggcggcgggaggcgggggagcg
ggagcgggagcggcgggggagggggcgctgtcgttcctgtcgcgcggcctccgggaggac
ctgcggctgatccgcgcgcgggcgggggagctggagacgttcctgaccgcgccggtgccg
gagccggagctgctcgcgcggctccggcgcgcgtactcgtcgtcggcggggaccacgcgg
ctggacctgtcggccatcgggaaggcgttcgggacgggggtggtggggagggggagcagg
ggggcgaggtgggggtgggaggaggtccaggaggccgaggagtgggagcccatacggatg
gtcaaggcgcgcctcagggagatggagcggaggcggcagtggcaggccaccgacatgctc
cacaaggtcaagctcagcttgaaatcaatgagctttgtacctgaagcatctgaggaagtt
ccaccgctagatttaggtgaactcctggcatatttcctaaagcaatctgggccattgttt
gaccaacttggtataaaaagagacgtgtgcgataagctggtggaatctctgtgcagcaaa
cgcaaggaccaccttgcatataattcatttccagcaagtgaaccatccgcattcagcaat
gacaatgctggtgatgaacttgacctaagaatagctagtgtcgtgcaaagtacaggacac
aattatgaaggtggattttggaatgatgggcataaatatgaaacagctgacaagaggcat
gttgcgatagtcaccactgccagtcttccctggatgactggaacagctgtaaatccttta
tttcgagctgcttacttggctaagtcttccaagcaagatgtaaccttggtggtgccttgg
ctttgcaagtctgatcaagaacttgtgtatcccaatagcatgacatttagttctccacaa
gaacaagaagcttatatgaggagttggctggaagaaagggttggtttcaagacagacttc
aaaatatcattctatcctggaaagtttcaaaaagaacggagaagcataattcctgcgggg
gacacttcacaatttataccatcaaaggaagctgacattgctattttggaagagcctgag
cacctgaactggtaccatcatgggaaacgttggactgataaatttaatcatgttgttggt
gttgtgcatacaaattatttggagtacattaaaagggagaagaatggtgttattcaagcc
ttttttgtgaagcacatcaacaatttggttgccagagcatattgccataaggttttgcga
ctgtcaggagctacacaagatctccccaagtccatgatctgcaatgtacatggtgtcaat
cccaagtttcttgaggttggagagagaattgcagcagagagggaatctggccagcattct
ttctccaaaggagcttattttctagggaagatggtctgggccaaaggttacagagaattg
atagatttgtatgccaaacacaagagtgatttggaaggcatcaagttggacatctatgga
aatggtgaagattcacatgaggtgcaatcagcggctatgaagttgaacctaaaccttaac
tttcataaaggccgggatcatgcggatgattctcttcatgggtacaaggtttttataaat
ccaagcattagtgatgtcctttgcactgcgaccgctgaggcattagcaatgggtaagttt
gttgtctgcgcagaccacccatcgaatgattttttcaggtcattcccgaactgtttgaca
tataaaacatcggaggactttgtcgcgaaagtgaaggaagcaatggcacgcgatccacaa
cccctcacacctgagcagagatacaacttatcctgggaggccgcaacacagagattcatg
gagcactccgagctggacaaggtcttgagcagcagcaacagggactgcaccaccagcacc
agtggatgtggtaaaagtggagacaataagatggaaaaatcagcctcgttgccgaacatg
tcagacatggtagatggtgggctggccttcgcccactactgcttcactggcaatgagctc
ctcagactgtcaaccggagcaatacccggcaccctcaattacaacaagcaacatagcttg
gacctccacctcttgccgcctcaggtacagaacccagtatacggctggtaa

DBGET integrated database retrieval system