KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329639
Entry
4329639           CDS       T01015                                 
Name
(RefSeq) N-glycosylase/DNA lyase OGG1
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4329639
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329639
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     4329639
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4329639
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4329639
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH
Other DBs
NCBI-GeneID: 4329639
NCBI-ProteinID: XP_015627252
UniProt: A0A0P0VKE7
LinkDB
Position
2:complement(20840735..20851084)
AA seq 416 aa
MGCHPPLPTVAAAAAAGMPPRRRRRVRPPLPPSPPLLSSTTATPPPTPPVGTPKSEAADR
RPPPARRRLPLVSAAAVEEEDGEWHPLPLSAADLSLPLTLPTGQTFLWRRTSLSPLRFTG
AVGPHLVSLSHLPSSDGRLAFLLHNNGGSSSSSVPAAARAALSDYLNAAVPLADLWRRFA
AADARFAEVSARLGGGGARVLRQDPVECVFQFLCSSNNNIARIEKMVWALAGYGERLGEV
GGYQFHQFPTIERLARVSEQELRDAGFGYRAKYIVGTAKILQAKPGGGEKWLASLRTREL
PEVIEALCTLPGVGPKVAACVALFSLDQNHAIPVDTHVWKVATQYLMPELAGKSLTPKLS
VAVADAFVAKFGNYAGWAQNVLFIGQLSAQKLMVAETTNTSTKPTKRKRSGNNVKT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggggtgtcatcctccccttccgaccgttgccgccgccgccgccgccgggatgccacct
cgccgccgccgccgagtccggccgccgctcccaccctcccctcccctcctctcttccacc
accgcaacaccaccgccaaccccgcccgtgggcacccccaaatccgaggccgccgaccgc
cgccctcctcccgcccgccgccgcctccccctcgtctccgccgccgccgtcgaggaggag
gacggagagtggcaccccctgccgctctccgccgccgacctgtccctcccgctcaccctc
cccacggggcagaccttcctgtggcgccgcacgtctctctccccgctccgcttcaccggc
gccgtggggcctcacctcgtctccctctcccacctcccgtcctccgacggccgcctcgcc
ttcctcctccacaacaacggcggctcctcctcctcctccgtccccgcggcggcccgcgcc
gcgctctccgactacctcaacgccgccgtgccgctcgccgacctctggcgccggttcgcc
gccgcggacgcgcggttcgcggaggtctccgcgcggctcgggggcggcggcgcccgggtg
ctcaggcaggaccccgtcgagtgcgtgttccagttcctctgctcctccaacaacaacatc
gcgcggatcgagaagatggtgtgggcgctggccggctacggggagcggctcggcgaggtt
ggaggataccaattccaccaattccccacgatcgagcggctcgcgcgcgtgtcggagcaa
gagctccgggatgccgggttcgggtacagggcaaagtacatcgtcggcactgctaaaata
ttacaggccaagcctggtggaggcgagaaatggcttgcctcattgcgtacaagggaactc
ccggaggtgattgaggctctttgcacccttccaggtgttgggccaaaagttgcagcctgt
gttgctttgttctcactcgatcagaaccatgctattcctgttgacacacatgtctggaag
gttgctacacaatatctgatgccggagctagctggcaagagcttaaccccaaaacttagt
gttgctgttgccgatgcatttgttgctaaatttgggaactatgctggttgggcacagaat
gttctctttattggccagctgtctgctcaaaaactcatggttgctgaaactacaaacact
tccacgaaacctactaaaaggaagcgtagtggaaacaatgtcaaaacatga

DBGET integrated database retrieval system