KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329643
Entry
4329643           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 8, chloroplastic isoform X1
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4329643
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4329643
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4329643
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4329643
NCBI-ProteinID: XP_015623105
UniProt: Q69SV0
LinkDB
Position
2:complement(20868300..20872075)
AA seq 478 aa
MAERIAASLLPAASPSPAPSPPPPRPRVSAAAAASFPCCSTSAGGLRLRSRPSRFPQKAA
TTRSGRAGAGARAVVRCMAAAAVAASDAAQLKSAREDIREILKTTYCHPIMVRLGWHDSG
TYDKNIEEWPQRGGADGSLRFDAELSHGANAGLINALKLIQPIKDKYPGITYADLFQLAS
ATAIEEAGGPKIPMKYGRVDVTAAEQCPPEGRLPDAGPRVPADHLREVFYRMGLDDKEIV
ALSGAHTLGRSRPDRSGWGKPETKYTKDGPGEPGGQSWTVEWLKFDNSYFKDIKEQRDQD
LLVLPTDAALFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSDLGAKFDPPEGFSLDDEP
AVEEKDPEPAPAPAAAPPPPPVEEKKEAEPTPVPVTVGAAVASSPADDNNGAAPQPEPFV
AAKYSYGKKELSDSMKQKIRAEYEGFGGSPDKPLQSNYFLNIMLLIGGLAFLTSLLGS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcggagcgcatcgccgcctccctcctcccggctgcctcgccctcgcctgctccgtcc
cctccccccccgcgcccccgcgtctccgccgcggccgccgcctccttcccatgctgctcc
accagcgccggcggcctccgcctccgctcccgcccgtctcgcttcccgcagaaggctgcg
acgacgaggagcgggcgcgccggcgcgggggcgcgggcggtggtccggtgcatggcggcg
gcggcggtggcggcgtccgacgcggcgcagctcaagagcgcccgggaggacatcagggag
atcctcaagaccacctactgccaccccatcatggtccgtcttgggtggcacgattctggc
acgtacgacaagaacatcgaggagtggccgcagaggggcggagccgacgggagcttgaga
tttgacgccgaattgagccacggagccaatgctggtctgattaatgctttgaagcttatc
caaccaatcaaggacaaatacccgggtataacttatgctgatttgttccagttggcaagt
gctacagcaattgaggaagctggtgggccgaaaattccaatgaaatatggacgagttgat
gtcacagcagctgagcagtgcccaccagaggggaggcttcctgatgccggtccacgtgtg
cccgctgatcatcttagggaggtattctacaggatgggccttgatgacaaggaaattgtt
gcattatctggagcacacacacttggaagatcaagacctgacaggagtggctggggaaag
ccagaaacaaaatatactaaggatgggcctggtgaacctggagggcaatcatggacagtt
gaatggttgaagtttgataacagttacttcaaggacataaaagagcaaagggaccaggat
cttctagtgctacccacagatgctgcattatttgaggatccgtccttcaaggtatatgcc
gaaaaatatgcagaggatcaggaggcattctttaaagactacgctgaagctcatgctaaa
ctgagcgaccttggtgcaaagttcgatccacctgagggattttcactggacgatgaacca
gccgtcgaagagaaggatcctgaaccagcaccagcgccagcagcagcaccaccacctcca
ccagtcgaggagaagaaggaagctgaaccaactccagtaccagtaacggtaggagcagca
gtggcatcatcgccagcggatgacaacaacggtgcagcaccgcaaccagagcccttcgtc
gctgcgaaatactcctacggaaagaaggagctgtcggactcgatgaagcagaagatcagg
gcggagtacgagggattcggaggcagcccggacaagcctctgcagtccaactacttcctc
aacatcatgctcttgatcggagggctggccttcttgacgtctctgctcgggagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332474
Entry
4332474           CDS       T01015                                 
Name
(RefSeq) L-ascorbate peroxidase 1, cytosolic
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4332474
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4332474
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4332474
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4332474
NCBI-ProteinID: XP_015630498
UniProt: Q10N21
LinkDB
Position
3:9843314..9846675
AA seq 250 aa
MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTM
KTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGRE
DKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT
RNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPLVEKYAADEKAFFEDYKEAHL
KLSELGFADA
NT seq 753 nt   +upstreamnt  +downstreamnt
atggctaagaactaccccgtcgtgagcgccgagtaccaggaggccgtcgagaaggccagg
cagaagctgcgcgccctcatcgccgagaagagctgcgcccctctcatgctccgcctcgcg
tggcactcggcggggacgttcgacgtgtcgtcgaagaccgggggcccgttcgggacgatg
aagaccccggcggagctgtcgcacgccgccaacgcggggctggacatcgcggtgcggatg
ctcgagcccatcaaggaggagatacccaccatctcctacgccgatttctaccagcttgcc
ggagttgtggccgtcgaggtgtccggtggacctgccgtccccttccacccaggaagggag
gacaaacctgcacccccacctgagggccgtcttcctgatgctaccaagggttctgaccac
ctaaggcaggtcttcggtgcgcagatgggcttgagtgatcaggacattgttgccctctct
ggcggtcacaccctgggaaggtgccacaaggaaagatctggttttgagggaccttggaca
agaaaccctctgcagtttgacaactcttacttcacggagcttctgagtggtgacaaggag
ggccttcttcagcttcctagtgacaaagccctgctgagtgaccctgccttccgcccactc
gtcgagaaatatgctgcagatgagaaggctttctttgaagactacaaggaggcccacctc
aagctctccgaactggggttcgctgatgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335202
Entry
4335202           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 3
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4335202
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4335202
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4335202
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4335202
NCBI-ProteinID: XP_015634435
UniProt: Q0JEQ2
LinkDB
Position
4:complement(8239237..8241896)
AA seq 291 aa
MSAAPVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIR
FPQEYSHAANAGIKIAIDLLEPMKQKHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRD
SSDSPEEGRLPDAKKGAAHLREVFYRMGLSDKDIVALSGGHTLGKARPERSGFDGAWTKD
PLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKL
SELGFTPPRSAFIYKSCQKPKSLLMQTAAGVAVAAAVVAWAYLCESNKRLG
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcggcggcgccggtagtggacgcggagtacatggcggaggtcgagagggcgcgccgc
gacctgcgcgccctcatcgccagcaagagctgcgctcccatcatgctccgcctggcgtgg
cacgacgccggcacgtacgacaaggcgacgaagacgggagggcccaacggctccatcagg
ttcccgcaggagtacagccacgccgcgaatgcgggcatcaagattgctattgatctgcta
gaaccgatgaaacagaagcatcccaagattacctatgctgacctgtatcagcttgccgga
gttgttgccgttgaagtcaccggtgggccaactatagattatgttcctggcaggagggat
tcttcagattccccagaggaaggccgtttgccagatgctaagaaaggtgctgcgcatctg
agggaagtcttctacaggatgggcttatcagacaaggacatagtagcactctcaggcggc
catactctcgggaaagctcgtcccgaaagatcaggatttgatggtgcctggacaaaggat
ccactgaaatttgacaactcctatttcattgagcttctgaaagagaattcagaagggctt
ctgaagttgcctactgacaaggctcttgttgaagatcctacattccgccgctatgtcgaa
ctatatgccaaggacgaagatgcatttttcagggactatgcagagtcgcacaagaagcta
tctgagctggggttcacgcctcctcgctctgcattcatctacaaatcatgccagaaacca
aagtccctgttgatgcaaactgcagctggggttgcagttgctgctgcagttgtcgcatgg
gcttacctctgtgaatccaacaagaggcttggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335896
Entry
4335896           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 7, chloroplastic
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4335896
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4335896
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4335896
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4335896
NCBI-ProteinID: XP_015635863
UniProt: Q7XJ02
LinkDB
Position
4:complement(21622952..21627259)
AA seq 359 aa
MAAQRLAALHAAAPSAFSSTSSASHGRPAARSSTTALLPVALPRASATLRAAPSRLLPQE
AKAAGSGRSVMCMASASASAASAAVASGAAELKAAREDIRELLKTTHCHPILVRLGWHDS
GTYDKNIKEWPQRGGANGSLRFDVELKHGANAGLVNALKLVQPIKDKYPNISYADLFQLA
SATAIEEAGGPKIPMTYGRIDVTGPEQCPPEGKLPDAGPSAPADHLRKVFYRMGLDDKEI
VVLSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTAEWLKFDNSYFKEIKEKRDQ
DLLVLPTDAALFEDPTFKVYAEKYAEDQEAFFKDYAGAHAKLSNLGAKFNPPEGFTLDG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcccagcgactcgccgccctccacgccgccgcgccgtcggccttctcctccacc
tcctccgcctcgcatggccgccccgcggcgcgatccagcaccaccgctctcctcccggtg
gccctcccgcgcgcctccgccaccctccgcgccgcaccttctcggctcctcccccaggag
gcgaaggcggcggggagcggcaggtcggtgatgtgcatggcgtcggcgtcggcgtcggcg
gcgtcggcggcggtggcgtcgggcgcggcggagctgaaggccgctcgcgaggacatcagg
gagctcctcaagacgacgcactgccaccccatcctggttcgtcttggatggcatgattcc
ggtacgtatgacaagaatattaaagagtggccacaacgaggtggagctaatggaagcttg
agatttgatgttgagttaaaacatggagccaatgctgggctggtaaatgctctaaagctt
gtccaacctatcaaggacaaatacccaaatatctcatatgcggatttattccagctggca
agtgctacagcaattgaggaagctggtggtccaaagattccaatgacatatggacggatt
gatgtcacaggtcctgagcagtgtccacctgaggggaagcttcccgatgctggcccaagt
gcacctgcggatcacttgaggaaggtattttacaggatgggtcttgatgacaaggagatt
gttgtgctgtctggagcacatacacttggaaggtccagacctgaacggagtggctggggg
aaaccagaaacgaaatatactaagaatggccctggtgcacctggtgggcaatcgtggaca
gctgaatggcttaagtttgataacagttatttcaaggagataaaagagaaaagagatcag
gatctcctggtcttgcctacagatgctgcattatttgaggacccaacattcaaggtctat
gcagaaaaatacgcagaggaccaagaagcattctttaaagactatgccggagctcatgct
aaactgagcaatctgggtgcaaaattcaatcctcctgagggattcacgttggacggttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336886
Entry
4336886           CDS       T01015                                 
Name
(RefSeq) thylakoid lumenal 29 kDa protein, chloroplastic
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4336886
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4336886
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4336886
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4336886
NCBI-ProteinID: XP_015636056
UniProt: A0A8J8XUN3 Q0JAF4
LinkDB
Position
4:30385517..30388287
AA seq 353 aa
MAGASFLSTVRQPPAPPPPLLAPRGSASSVSSPARRHAHILVCCHATAQEEPVRFRRRDL
IGGCLTTAIGLELVEGSTGFTGVATAADLIERRQRSEFQSSIKSTLATAITAKKELIPSL
LTLALNDAMTYDKATKSGGPNGSVRLSAEISRPENSGLSAAVDLLVEAKKEIDSYSKGGP
IAFADLIQFAAQSALKLTFVDAAIAKCGGNEEKGRTLYSAYGSNGQWGLFDKLFGRQDTQ
EPDPEGRVPDWSKASVQEMKDKFVAVGLGPRQLAVMSVFLGPDQAATEERLIADKDCRPW
VEKYQRSRETVSRTDYEVDLITTLTKLSSLGQKINYEAYTYPKQKIDLGKLKL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcgggcgcgagcttcctctcgaccgtgcggcagcctcccgcgccgccgccgccgctg
ctcgccccacgcggctccgcttcctccgtctcgtctcccgcgcgacggcacgcccacatt
ctggtgtgctgccatgctaccgcgcaggaagagcctgtgcgattccgtagaagggattta
atcggcggctgcttgactactgccattggcttggaattagtcgagggctctacaggattc
acaggagtggctactgcagctgatctgattgagcgtcgacaacgctctgaattccaatca
agcatcaaaagcaccctcgccacagccataacggctaaaaaagagctcattccatctttg
ttgacgttggcactgaatgatgccatgacatatgataaggccacgaagtcaggaggtcca
aatggatcggtcaggctaagtgcagaaataagcagacctgaaaacagtggactttctgct
gctgtggatctgctagttgaagcgaaaaaggagatagattcctactccaagggaggaccc
attgcatttgcagatctgatccaatttgcagcacaatcagcactcaagctaacattcgtt
gatgcggccattgccaaatgtggcgggaacgaagaaaaaggaagaacactatactcagct
tatggttcaaatggccagtggggtttattcgacaaactgttcgggcgacaagatacacag
gaacctgatcctgaaggaagggtacctgactggagcaaagcttctgtgcaggaaatgaag
gataagttcgtcgcagttggtttgggtcctcgtcagcttgctgtgatgtcagtcttcctg
gggcctgaccaagctgccacggaggaacggttgatagccgacaaggattgccgcccatgg
gtcgagaagtatcaacgcagtcgcgagacggtctctcgaactgactacgaggttgacctg
ataaccacgctcacaaagctgagctcccttgggcagaagataaactacgaggcctacacg
taccctaagcaaaagattgacttgggtaaattgaaattgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344397
Entry
4344397           CDS       T01015                                 
Name
(RefSeq) L-ascorbate peroxidase 2, cytosolic
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4344397
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4344397
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4344397
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4344397
NCBI-ProteinID: XP_015646556
UniProt: Q9FE01 A0A345YV75
LinkDB
Position
7:complement(29584030..29586347)
AA seq 251 aa
MGSKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGT
MKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGR
QDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGFEGAW
TSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPLVEKYAADEDAFFADYAEAH
LKLSELGFAEE
NT seq 756 nt   +upstreamnt  +downstreamnt
atgggcagcaagtcgtacccgacggtgagcgatgagtacctggcggccgtgggcaaggcg
aagcgcaagctccgcggcctcatcgccgagaagaactgcgccccactcatgctccgcctc
gcgtggcactctgctggcaccttcgatgtgtcgtcgaggaccggcgggcccttcggcacc
atgaagaaccccggcgagcagtcccacgccgccaacgccggcctcgacatcgccgtcagg
cttctcgaccccatcaaggaccaacttcccatcctctcctacgccgacttctaccagctt
gctggcgttgtggccgtcgaggtcaccggcggacctgaggtccccttccatccgggcagg
caggacaagcctgagcctcctcctgaaggccgtcttcctgatgccacacaaggttctgac
cacctaaggcaggtcttttctgcgcagatgggtttgagtgacaaggacatagttgctctt
tctggtggtcacaccctgggaagatgccacaaggagagatctggctttgagggagcctgg
acgtccaaccctttgatctttgacaactcttacttcaccgagcttgtgagtggcgagaag
gaaggccttcttcagctgccaagtgacaaagccctcatggctgacccagccttccgtcca
ctggtggagaaatatgctgcggatgaggacgccttctttgcggattacgccgaggcccac
ctcaagctctctgaactgggatttgctgaggaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346078
Entry
4346078           CDS       T01015                                 
Name
(RefSeq) putative L-ascorbate peroxidase 6
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4346078
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4346078
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4346078
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4346078
NCBI-ProteinID: XP_015650820
UniProt: A3BUY8
LinkDB
Position
8:complement(25971775..25975004)
AA seq 331 aa
MELTNVPHIAASSRFFSSCSRCTCRIRRSGKTRIGASAAGRRCSSDDSACSEPSEQQNAD
FFSGPISSLCYTRRDFASVALLPFILPHVHIASAAEPIDGSIIQNGVRNVLSKVKAAGML
RLAFHDAGTFDIADKSGGMNGSIIYEVDRPENTGLNKSIKVLGKAKEVIDLVQQVSWADL
IAVAGAESVALCGGPEIPVRLGRLDSSTADPAGKLPEETLDATALKTLFSKKGFSTQEMV
VLSGAHTIGGKGFGNPNIFDNSYFKVLLEKPQPSSSGMPAMVGLRTDWALTEDDECLRWI
NLYAQDQAKFFADFKDAYIKLVNTGASWRSA
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagctcactaatgtcccccatattgcagcctcctcccgcttcttctccagctgcagt
cgttgcacctgcaggattagaagaagtgggaagacgaggataggagcttctgctgctggt
cgtaggtgcagtagtgatgattctgcttgttcagaaccctctgagcagcaaaatgcagat
ttcttttcaggtcccatatcttctctttgttatacaaggagggactttgcttctgttgct
ctgctccctttcatacttcctcatgttcatatagcgagtgcggctgagccaattgatggt
tcaattattcaaaacggtgtgaggaatgttttatccaaggtcaaggctgctggcatgctt
cgtttggctttccatgatgcagggacttttgatattgctgataaatcaggtggcatgaat
ggatctataatttatgaagttgatagacctgaaaatactgggctaaataaatccataaag
gtattaggaaaagcgaaagaagtaattgaccttgtgcagcaagtatcatgggcggatttg
attgccgtggctggtgctgagtcagttgcgctatgtggagggccagaaattccagtaaga
ctaggtcgattagattccagtactgctgatcctgctggtaaacttcctgaagaaacattg
gatgccactgcgctgaaaacattattcagcaaaaagggcttttcgacacaggagatggtt
gtgttatctggagcacacacaattggaggtaaaggattcgggaatccaaatattttcgac
aactcctattttaaagtactccttgagaagccacagccatcttcatctggcatgccggca
atggtaggactgcgaacggattgggcactcactgaagatgatgaatgcttaagatggatc
aatttatatgcacaggaccaagctaaattttttgccgacttcaaggatgcatacatcaag
cttgtaaatactggagcctcatggagatcagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346247
Entry
4346247           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 4
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4346247
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4346247
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4346247
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4346247
NCBI-ProteinID: XP_015650808
UniProt: Q6ZJJ1
LinkDB
Position
8:complement(27555336..27559365)
AA seq 291 aa
MAAPVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRY
EEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDS
SVCPREGRLPDAKKGALHLRDIFYRMGLSDKDIVALSGGHTLGRAHPERSGFEGAWTQEP
LKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLS
ELGFTPRSSGPASTKSDLSTGAVLAQSAVGVAVAAAVVIVSYLYEASKKSK
NT seq 876 nt   +upstreamnt  +downstreamnt
atggccgccccggtcgtggacgccgagtacctccgccaggtcgacagggcgcgccgccac
ctccgcgccctcatctcctccaagggatgcgcgcccatcatgctccgcctcgcatggcat
gacgcgggcacttatgacgtgaacacaaaaactggtggtgcaaatggttcaattagatac
gaggaagagtacactcacggttcaaatgctggtctaaagattgctattgatcttctcgag
cctattaaagccaagagccctaagatcacatatgctgacctttatcagcttgctggagtt
gttgcagttgaagttactgggggtccaactgttgagttcattcctggaagacgtgattcg
tcagtttgcccccgtgaagggcgtcttcctgatgctaagaaaggtgcactgcacttgagg
gacatcttttaccggatgggcttatcagacaaagatatagtagctttatctgggggtcac
actctgggaagggcacatcctgaaaggtctggatttgaaggcgcatggactcaggagcct
ctgaagtttgacaattcgtactttcttgagctactgaagggggaatctgaggggcttctg
aagctcccaactgacaaggcattgttggaagatccttcatttagacgctatgtggatctt
tatgccagggatgaagacaccttcttcaaggactacgctgaatcgcacaagaagctttct
gaacttggcttcactccacggagcagcggccctgcatctacgaaatctgatctttcaact
ggtgctgtactcgcacagagtgctgtcggggtagctgttgctgcagctgtagttatcgtg
agctacctatacgaggcttctaagaagagcaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351663
Entry
4351663           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 6, chloroplastic
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4351663
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4351663
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4351663
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4351663
NCBI-ProteinID: XP_015618175
UniProt: P0C0L1
LinkDB
Position
12:complement(3955958..3959860)
AA seq 309 aa
MAVVHRLLRRGLSAASPLPSLQELGRRPASSSAAAAGDAAAELRGAREDVKQLLKSTSCH
PILVRLGWHDAGTYDKNITEWPKCGGANGSLRFEIELKHAANAGLVNALKLIQPIKDKHA
GVTYADLFQLASATAIEEAGGPKIPMIYGRVDVAAPEQCPPEGRLPAAGPPSPAEHLREV
FYRMGLSDKEIVALSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTSQWLKFDNS
YFKDIKERRDEDLLVLPTDAVLFEDSSFKIYAEKYAADQDAFFEDYAEAHAKLSNLGAKF
DPPKGISLE
NT seq 930 nt   +upstreamnt  +downstreamnt
atggccgtcgtccaccgcctcctccgccgcggcctctccgccgcctctcccctcccctct
cttcaggagctcgggaggcgtccggcgagctcgtcggcggcggcggcgggggacgcggcg
gctgagctgcggggcgcgcgggaggacgtcaagcagctgctcaagtccacctcctgccat
cccatcctggttcggttagggtggcatgatgctggtacttatgacaagaacattactgaa
tggccaaagtgtggtggtgccaatggtagcttgagattcgaaattgagttaaaacatgcg
gctaatgcaggtcttgtgaatgctttgaagctgatccagcccatcaaagacaagcatgca
ggtgtcacttatgcagatctgtttcagctcgccagtgctacagccattgaggaagccggt
ggccccaagatccccatgatctatggaagggttgatgttgctgcccctgaacaatgcccg
ccagaggggagacttcctgctgctggccctccttcacctgcggaacatctacgagaagta
ttctatagaatgggcctgagtgacaaggaaattgttgcattgtcaggagctcatacactt
ggacgatctagaccagagcgcagtggatggggcaaaccagaaactaaatacactaaaaac
ggacctggtgcacctggagggcaatcttggacatcacagtggctgaagtttgataatagc
tacttcaaggacatcaaagaacgccgagatgaggaccttctagttctgcctactgatgct
gtgctctttgaggactcatcattcaagatctatgctgaaaagtacgccgcagatcaggat
gcattttttgaagactatgctgaagctcatgccaaactgagcaatctcggagcaaagttt
gatcctccaaagggtatttcactggaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351664
Entry
4351664           CDS       T01015                                 
Name
(RefSeq) probable L-ascorbate peroxidase 5, chloroplastic isoform X2
  KO
K00434  L-ascorbate peroxidase [EC:1.11.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4351664
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4351664
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.11  L-ascorbate peroxidase
     4351664
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4351664
NCBI-ProteinID: XP_015618477
UniProt: P0C0L0
LinkDB
Position
12:complement(3960506..3964017)
AA seq 320 aa
MAVVHRILRRGLSAASPLPSLRGLLLVSPQELGRRPASSSSSAAAAAGDVEAELRAARED
VRQLLKSNPCHPILVRLGWHDAGTYDKNITEWPKCGGANGSLRFGVELVHAANKGLLKAL
FLVIPIKSKYAGVTYADIFQLASATAIEEAGGPKIPMIYGRADVADGEECPPEGRLPAAD
PPSPAEHLREVFYRMGLSDKEIVALSGAHTLGRARPERSGWGKPETKYTENGPGAPGGQS
WTSEWLKFDNSYFKEIKERRDEDLLVLPTDAVLFEDSSFKIHAEKYAEDQDAFFEDYAEA
HAKLSNLGAKFDPPKGISLE
NT seq 963 nt   +upstreamnt  +downstreamnt
atggccgtcgtgcaccgcatcctccgccgcgggctctccgccgcctctcccctcccttct
ctccgcggcctcctcctcgtctcccctcaggagctcggcaggcgtccggcgagctcgtcg
tcgtcggcggcggcggctgcgggggacgtggaggctgagctgcgcgccgcgcgggaggac
gtcaggcagctgctcaagtccaacccctgccatcccatcctggttcggttagggtggcat
gacgctggcacttacgataagaacatcactgaatggccaaagtgtggtggtgcgaatggt
agcttgagatttggagttgagttagtacatgcagctaacaaaggtcttctgaaggcgtta
ttcttggtcattcccatcaagagcaagtatgcaggtgtcacttatgcagatatatttcaa
cttgccagtgctacagccattgaggaagccggtggccccaagatccccatgatctatgga
agggctgatgttgctgatggtgaagaatgcccacctgaggggagacttcctgctgctgac
ccaccttcacctgctgaacacttgcgagaagtattctacagaatgggcctgagtgacaag
gaaattgttgcgttgtcaggagctcatacacttggtcgagctagaccagagcgtagtgga
tggggtaaaccagaaacaaaatacactgaaaatgggcctggtgctcctggagggcaatct
tggacatctgagtggctcaagtttgacaacagctacttcaaggaaatcaaagaacgccga
gatgaggatcttctagttctccctactgatgctgtgctctttgaggactcatcattcaag
atccatgctgaaaagtatgctgaggatcaggatgcatttttcgaagactatgctgaagct
catgccaaactgagcaatcttggggcaaagtttgatcctccaaagggtatttcacttgaa
tag

DBGET integrated database retrieval system