KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329702
Entry
4329702           CDS       T01015                                 
Name
(RefSeq) probable signal peptidase complex subunit 2
  KO
K12947  signal peptidase complex subunit 2 [EC:3.4.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4329702
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     4329702
SSDB
Motif
Pfam: SPC25
Other DBs
NCBI-GeneID: 4329702
NCBI-ProteinID: XP_015623270
UniProt: A3A843 Q6Z7E3
LinkDB
Position
2:complement(21462242..21464521)
AA seq 191 aa
MATDGGGATPSPAAKKANLLDPYSIKHLLDETVSEVAKSKGYPEDARLSNRRLAVGAAVI
AVALLAQFYPRKFPENRDVLLACIALYAALNVALQIVTYTKEKNAILFTYPPAGSFNRTG
LVISSKLPRLSDMYTLTIASADPHSKSSSEPVHFTKSVTKWFTKDGVLVEGLFWKDVEKL
IDDYNSDHRSK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcgaccgacggcggcggcgccaccccctcaccggcggcgaagaaggccaacctcctc
gacccctactccatcaagcatctcctcgacgagaccgtctccgaggtcgcgaagagcaag
gggtacccagaggacgcgcggctgagcaaccggaggctggcggtcggcgcggcggtgatc
gccgtcgcgctcctcgcgcagttctacccccgcaagttccccgagaacagggacgtcctc
ctcgcctgcatcgcgctgtacgcggcgctcaacgtggcgctgcagatcgttacctacacc
aaggagaagaacgccatcctcttcacgtaccctcccgcgggatcatttaataggactggg
cttgttatatcttcaaagttaccaagattgtcagacatgtataccctcacaatagcaagt
gcagatccacattctaaatcttccagtgaaccagtccatttcactaagagtgtcacaaaa
tggttcaccaaggatggggttcttgtggaaggtttgttctggaaggatgttgagaaactg
attgatgactacaacagtgaccacaggagcaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335967
Entry
4335967           CDS       T01015                                 
Name
(RefSeq) probable signal peptidase complex subunit 2
  KO
K12947  signal peptidase complex subunit 2 [EC:3.4.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4335967
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     4335967
SSDB
Motif
Pfam: SPC25
Other DBs
NCBI-GeneID: 4335967
NCBI-ProteinID: XP_015633680
UniProt: Q7XUX4 B9FFE3
LinkDB
Position
4:complement(22246711..22249717)
AA seq 192 aa
MASDGAAATPAKASPKKANLLDPHSIKHLLDETISDVVKSKGYAEDTRLGNWKLAIGAAV
IAIALLAQFYPKKFPQNREFLLGCIALYVVLNVVLLILSYTKEKDAIMFTHPPAGSFNST
GLVISSKLPRFSDMYTITIASADPQSISANKPVHFTKSVTKWFTKEGVLVEGLFWKDVER
LIDDYNTERKGK
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcgagcgacggcgcggcggccacgccggcgaaggcgagcccgaagaaggccaacctc
ctcgacccccactccatcaagcacctcctcgacgagaccatctccgacgtcgtgaagagc
aagggctacgcggaggacacgcggctgggcaactggaagctggcgattggggcggccgtg
atcgccatcgctctcctcgcgcagttctacccgaagaagttcccccagaaccgcgagttc
ctcctcggctgcatcgcattatatgtggtgttgaatgtggtgctgttgatacttagctat
accaaggaaaaggatgccattatgttcacacaccctcctgcgggttctttcaatagcact
ggactagttatatcttcaaaattaccaagattctcggatatgtacactatcacaatagcc
agtgcagatccccagtctatttccgccaataagccagttcatttcactaagagtgttaca
aaatggtttactaaggaaggagttctcgtggaaggcctgttctggaaggatgttgagagg
ttgattgatgactacaacactgagcgcaagggcaaatga

DBGET integrated database retrieval system