KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329733
Entry
4329733           CDS       T01015                                 
Name
(RefSeq) probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4329733
   00790 Folate biosynthesis
    4329733
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     4329733
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     4329733
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 SWM_repeat
Other DBs
NCBI-GeneID: 4329733
NCBI-ProteinID: XP_015626297
UniProt: Q0E079
LinkDB
Position
2:complement(21930650..21935559)
AA seq 553 aa
MASISPTSSSVAALRGHPVQFVKGGAVSKEAKGSISFSPVANSNNANVKFTGLRVAASLK
RDGAFPGDGYSGNDNTVLPKSTSVRGQDYPTADSVLPTESIIVPEISNAGLKCVADMFSD
EDKDTEQDLDSPTEGFSSISEAIKDIQQGKLVIVVDDESRENEGDLIMAASLVTPEAMAF
VVRYGTGIVCVSMKEEDLERLNLPLMVATKENEEKLCTAFTVTVDAKEGTTTGVSAKDRA
KTVMTLASPDSKPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAMLAGLPPAAVLCEI
VDEDGSMARLPKLRVFAERENLKIVSIADLIRYRRKRDRLVERSSVARLPLRWGNVRAYC
YRSVIDGIEHIAMVKGEIGDGQGVLVRVHSECLTGDIFGSARCDCGDQLAMAMEMIEKAG
RGVLVYLRGHEGRGIGLGHKLRAYNLQDDGRDTVEANEDLGLPVDSREYGIGAQILRDLG
VRSMKLMTNNPAKYGGLKGYGLSIVGRVPLVTPITSENRRYLETKRTKMGHVYGLANGQA
SHQTGSNGAKGEH
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcgtcgatttcgccgacgtcttcatcggtcgccgccctccgcggccacccggtgcag
ttcgtgaaaggcggtgcagtctccaaggaagcaaagggatcaatttccttctcacccgtt
gcgaattcaaataatgccaatgtgaaatttacgggcttgagggtagcagcatcattgaaa
agggatggtgcttttccaggcgacggttactcagggaatgataacacggtgttaccaaag
agcacttctgttcgtggccaggactatccaactgctgactctgtactcccaacggaatcc
atcatcgtgccagaaatcagtaatgctggtttgaaatgtgttgcggacatgttctcagat
gaggacaaagacactgaacaagatttggatagcccaactgagggcttctcgtctatttcc
gaggccatcaaagatattcaacaaggaaaacttgtgattgttgttgacgatgaatcaaga
gaaaatgagggagatcttataatggctgcttctttggttaccccagaggccatggcgttt
gttgtaagatatggcacaggaatagtgtgtgttagcatgaaagaagaggatcttgaaaga
ttgaaccttcctttgatggttgcaacaaaggaaaatgaggagaagctctgtactgcattc
actgttacagtggatgctaaagagggaacaacaactggggtatctgcaaaggatagggca
aagacagttatgactcttgcatcccctgactctaagcctgaagacttcaatcggcctggt
catattttccctctgaaatacagagagggtggtgttctgaaacgagctggacatactgaa
gcatctgtagatcttgctatgttagctgggttacctcctgctgcggtcttatgtgagatt
gtggatgaggatgggtccatggctcgcctaccaaagctgcgcgtgtttgctgaaagggag
aatttgaagattgtatccattgctgacttgattagatataggagaaaaagagacaggcta
gttgaacgttcatctgttgcacgcttacctttgagatggggtaatgtccgcgcttactgc
tacagatctgttattgatgggatagagcatattgcaatggtgaaaggggagattggagat
ggtcaaggcgttttagtgagggtgcactccgaatgcctcacaggggacatttttggatca
gcaagatgtgattgtggtgatcagcttgccatggcaatggagatgattgagaaggctgga
aggggtgtactagtttatcttcgtggacatgaagggaggggtattggtctcggtcacaag
ctccgtgcttataacctgcaagatgacgggcgcgacactgtggaggctaatgaagaccta
ggactgcctgtggattcacgggaatatggcattggtgcacagatattacgtgatctgggg
gtccgttcaatgaagttgatgactaataacccagcaaagtatggtggtctcaagggttat
ggattgagcattgtgggcagggttcccttggtaactccaatcacctcagagaatcggaga
tacctggaaacaaagagaacaaagatggggcatgtatatggattggccaatggccaagct
agccatcagacgggcagcaatggtgccaaaggggagcattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339017
Entry
4339017           CDS       T01015                                 
Name
(RefSeq) probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic isoform X1
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4339017
   00790 Folate biosynthesis
    4339017
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     4339017
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     4339017
SSDB
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Other DBs
NCBI-GeneID: 4339017
NCBI-ProteinID: XP_015637605
UniProt: Q6L506
LinkDB
Position
5:complement(22625669..22629126)
AA seq 536 aa
MDRVLLSSQLSSQTVVNTRVQQGSGGINSIGFAVIRKGSLKLRCYAIGGLGGGENLNDPL
KESNNGPVLQGFNGSSASFRTVGAKITQETGDFFVSDAEGDPDKPTDGFSSIDEAIGALH
EGKFVIAVDDESGDNEGDLVMAATLADPESIAFMIRNGSGIISVGMKEEDLTRLMIPMMS
PIAEIEDISAAASTVTVDARVGISTGVSAADRAKTIFTLASPDSKPTDLRRPGHIFPLKY
RNGGVLKRAGHTEASVDLVALAGLRPVSVLSTVINPVDGSMAGMPVLKQMALEHDIPIVS
IADLIRYRRKREKLVELIAVSRLPTKWGLFRAYCYQSKLDGTEHIAVAKGDIGDGEDVLV
RVHSECLTGDILGSARCDCGNQLDLAMQLIDKAGRGVLVYLRGHEGRGIGLGQKLRAYNL
QDDGHDTVQANVELGLAVDSREYGIGAQILRDMGVRTMRLMTNNPAKFVGLKGYGLAVVG
RVPVISPITKENQRYLETKRTKMGHVYGSDLPGNVPEEFLNPDDIAGDQDEDDTHN
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggaccgtgttcttctgagctctcaattgtcatcacaaacggttgttaacacaagggtt
caacaaggaagcggtggtatcaacagcataggatttgctgttatcagaaaggggagctta
aaattgagatgttatgcaattggtggacttgggggaggagagaatttgaatgatccttta
aaggaaagcaataatggacctgttttgcaaggattcaatggatctagtgcttcctttcgg
actgttggtgctaaaatcactcaggaaactggtgatttctttgttagcgatgcagagggt
gacccagacaaaccaactgatggtttttcctctattgatgaggctataggcgcattgcat
gaaggaaagtttgttattgctgtagatgatgaaagcggtgataatgaaggggatcttgtc
atggcagctacgctggcagacccagaatctattgcattcatgatcaggaatggttctggg
atcatctcagtgggcatgaaggaagaggacttaacaagattgatgattcctatgatgtct
ccaattgcagaaattgaggatatttcagctgctgcttccacagtaacagtggatgccaga
gtgggcatatcaaccggcgtctcggctgcagatagggcaaaaacgatttttactctagcc
tcccctgattctaagccaactgacctcagaagaccaggccatatattccctctaaaatac
cgaaacggtggtgtgctaaaaagagctggacatactgaggcatccgtcgatcttgtcgcg
ttggctggcttgcgccctgtgtctgtcctgtcaaccgtcatcaacccagtggatggttca
atggcaggaatgccagtgctgaaacagatggctttggagcatgatatcccaattgtttca
atcgctgatctcatccggtatagaaggaagagggagaagctggtggaactgattgctgta
tctcgtttgccgacgaaatggggccttttccgagcttactgctaccaatccaagcttgat
ggaaccgagcacattgctgttgcaaagggcgacatcggcgacggcgaggacgtcttggtg
agggtccattccgagtgcctgaccggcgacatcctcggctccgcccgctgcgactgcggc
aaccagctggacctggcgatgcagctcatcgacaaggccggccgcggcgtcctcgtctac
ctccgcggccacgagggccgcggcatcggcctcggccagaagctccgcgcctacaacctc
caggacgacggccacgacaccgtccaggccaacgtcgagctcggcctcgccgtcgactcc
cgcgagtacggcatcggcgcccagattctgcgggacatgggggtgcgcacgatgcggctg
atgacgaacaacccggcaaagttcgtcgggctcaagggctacgggctcgccgtcgtcggc
agggttccggtgatctcccccatcaccaaggagaaccagaggtacctcgagacgaagcgc
accaagatgggccatgtctacggctccgacctccccggcaacgtcccggaggaattcctc
aacccggacgacatcgccggagaccaagacgaagacgacacccacaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270160
Entry
9270160           CDS       T01015                                 
Name
(RefSeq) probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    9270160
   00790 Folate biosynthesis
    9270160
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     9270160
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     9270160
SSDB
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Other DBs
NCBI-GeneID: 9270160
NCBI-ProteinID: XP_015651119
UniProt: A0A0P0XGW9
LinkDB
Position
8:23829310..23833496
AA seq 546 aa
MDSCTANLMSRLSSIYSQHRTSGLRSDRSIMPNSTSNSLRTISSVHLPYNHRARNFHISH
AVGDSSEHVIINGQASPSKVVQADAAALGTIAADMAPVVDGFSADDDELDLDSPTEGFSS
IPEAIEDIRQGKYVIVVDDEDRENEGDLIMAASKVTPEAMAFIVRHGTGIVCVSMKEDDL
ERLELPLMVTTKENEEKLRTAFTVSVDAKEGTTTGVSAKDRANTVLALASPNSKPEDFNR
PGHIFPLKYREGGVLKRAGHTEASVDLAMLAGLPPAAVLCEIVDDDDGSMALLPKLQDFA
RRENLKIISIADLIRYRRKRDRLVERVCVTPLQLQWGSFQSYCYRSLIDGMEHIAMVKGD
VGDGQDILVRVHSECLTGDIFGSARCDCGNQLALAMTMIEKTGRGVVVYLRGHEGRGIGL
GHKLRAYNLQDDGRDTVEANEDLGLPVDSREYGIGAQILRDLGVRTMRLMTNNPAKYTGL
KGYGLSVLGRVPLLTPITNENRRYMETKRLKMGHVYGTRPSGNTSTLADGGIKKEQDQID
SASEQE
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggattcctgtactgcaaatctcatgtcacggctgagcagcatttacagccaacacagg
acttctggattgcggtctgatcgttcaattatgccaaattctacatcaaacagtttgagg
acaatcagttctgttcacttgccgtataaccatcgggccagaaattttcatatatctcat
gctgtgggtgattcttcagaacatgttattataaatggacaggctagtccttctaaagtg
gttcaagcagatgctgctgcacttgggaccatagctgctgatatggcacctgttgttgat
ggtttttctgctgatgatgacgagcttgacctagacagcccaactgagggtttctcatcc
attcctgaagctattgaggatattcgccaaggaaaatatgtgattgttgtggacgatgaa
gatagagagaatgaaggagatcttataatggcagcatcaaaggtgacacctgaggctatg
gctttcatagtgaggcatgggacaggcattgtatgtgtcagcatgaaagaagatgacctg
gaaagactagaacttcctcttatggtgacaacaaaggaaaatgaagagaagctgcggact
gccttcactgtttcagtggatgctaaagaaggcacaacaacaggggtttcagctaaggat
cgggcaaatacagtcttagcacttgcatctcctaattctaagcctgaagacttcaacagg
ccaggacatatttttcctcttaaatatagagaaggaggtgtgctgaaaagggctgggcat
actgaagcatcagttgaccttgccatgttggctgggttacctcctgctgctgttctttgt
gaaattgttgatgatgacgatggatccatggctttattgccaaaactccaagattttgca
agaagggagaacctgaagataatttcaattgcggacttgattaggtataggaggaagaga
gacagattggtagaacgtgtttgtgttacacctttacaattacaatggggatcatttcaa
tcttattgctaccgatctcttattgatgggatggagcacattgctatggtcaagggtgat
gttggtgatggccaggatatcttagtgcgagtgcattcggagtgcctaactggagatata
tttggatcagccaggtgtgattgtgggaatcaacttgccctggcaatgaccatgattgag
aagactggcaggggtgtagtagtttaccttcgtggacatgaaggtaggggcattggtttg
ggtcacaagcttcgtgcatacaatttgcaggacgatgggcgggatactgttgaggctaat
gaggatctaggtctgccggttgattcacgagagtacggtattggtgcacagatactacga
gatcttggtgtccgaaccatgaggcttatgactaacaatcctgcgaaatatactggactg
aagggctatggtttgagtgtcttgggcagagtgccactgttgacaccaataaccaatgag
aatcggcgttacatggaaacaaagagattaaagatggggcatgtttatggaacccggcct
agtggtaatacaagcaccttggctgatggcggcataaaaaaggagcaagatcagattgac
agtgctagcgagcaagagtaa

DBGET integrated database retrieval system