KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329738
Entry
4329738           CDS       T01015                                 
Name
(RefSeq) cryptochrome-1 isoform X1
  KO
K12118  cryptochrome 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4329738
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Cryptochrome_C
Other DBs
NCBI-GeneID: 4329738
NCBI-ProteinID: XP_015625401
UniProt: A0A0P0VKP4 Q6YXC2
LinkDB
Position
2:21976454..21980296
AA seq 718 aa
MSASPSSMSGAGAGEAGVRTVVWFRRDLRVEDNPALAAAARAAGEVVPVYVWAPEEDGPY
YPGRVSRWWLSQSLKHLDASLRRLGASRLVTRRSADAVVALIELVRSIGATHLFFNHLYD
PLSLVRDHRVKALLTAEGIAVQSFNADLLYEPWEVVDDDGCPFTMFAPFWDRCLCMPDPA
APLLPPKRIAPGELPARRCPSDELVFEDESERGSNALLARAWSPGWQNADKALAAFLNGP
LMDYSVNRKKADSASTSLLSPYLHFGELSVRKVFHQVRMKQLMWSNEGNHAGDESCVLFL
RSIGLREYSRYLTFNHPCSLEKPLLAHLRFFPWVVDEVYFKVWRQGRTGYPLVDAGMREL
WATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGSLPDGR
ELDRIDNPQLEGYKFDPHGEYVRRWLPELARLPTEWIHHPWDAPESVLQAAGIELGSNYP
LPIVELDAAKTRLQDALSEMWELEAASRAAMENGMEEGLGDSSDVPPIAFPPELQMEVDR
APAQPTVHGPTTAGRRREDQMVPSMTSSLVRAETELSADFDNSMDSRPEVPSQVLFQPRM
EREETVDGGGGGGMVGRSNGGGHQGQHQQQQHNFQTTIHRARGVAPSTSEASSNWTGREG
GVVPVWSPPAASGPSDHYAADEADITSRSYLDRHPQSHTLMNWSQLSQSLTTGWEVEN
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgtcagcgtcgccgtcgtcgatgagcggcgccggcgccggcgaggcgggggtgcggacg
gtggtgtggttcaggcgggacctgcgcgtggaggacaacccggcgctggcggcggcggcg
cgggcggccggggaggtggtgccggtgtacgtgtgggcgccggaggaggacgggccgtac
tacccggggcgggtgtcccggtggtggctcagccagagcctcaagcacctggacgcctcg
ctccggcggctcggcgccagcaggctcgtcacccgccgctccgccgacgccgtcgtcgcg
ctcatcgagctcgtccgcagcatcggcgccacgcatctcttcttcaaccacctctacgac
ccgctgtcgctggtgagggaccaccgggtgaaggcgctgctgacggccgagggcatcgcc
gtgcagtcgttcaacgccgacctgctgtacgagccatgggaggtggtcgacgacgacggc
tgcccgttcaccatgttcgcgccgttctgggacaggtgcctgtgcatgcccgacccggcg
gcgccgctgctgccgcccaagaggatcgcgcccggcgagctgccggcgaggaggtgcccc
tccgacgagctggtgttcgaggacgagtccgagcgggggagcaacgcgctgctggcgagg
gcgtggtcgcccgggtggcagaacgccgacaaggcgctggccgcgttcctcaacgggcca
ctcatggactactcggtgaaccggaagaaggccgacagcgccagcacgtcactgctgtcg
ccgtacctgcacttcggcgagctcagcgtacgcaaggtgttccaccaggtgaggatgaag
cagctcatgtggagcaacgaggggaaccacgccggcgacgagagctgcgtcctcttcctc
cggtccatcggcctcagggagtactcgaggtacctcacgttcaaccacccgtgcagcctg
gagaagccactcctggcgcacctcaggttcttcccctgggtggtcgacgaggtgtacttc
aaggtgtggaggcaggggaggacagggtaccctctcgtcgacgccgggatgcgcgagctc
tgggccaccggctggctgcacgaccggatacgcgtcgtcgtctccagcttcttcgtcaag
gtgctccagcttccatggcgctgggggatgaagtacttctgggacaccctgctcgacgcc
gacctcgagagcgacgcgctcggctggcagtacatctccggctctctccccgatggccgt
gagctcgaccgcatcgacaaccctcagcttgaaggatacaagtttgatccgcacggggag
tatgtccggcgatggctgccggagctggcaaggctgccgacggagtggatacaccaccca
tgggacgcaccggagtcggtgctccaggctgcagggattgagctaggctccaactatcct
ctccccatcgtggagctggacgcggcgaagaccaggctgcaggatgcactgtcagagatg
tgggagctcgaggccgcgtcacgcgcagcgatggagaacggaatggaggagggcctcggc
gactcctccgacgtgccgccgatcgccttcccaccggagctgcagatggaagttgaccga
gcaccggcccagcctactgttcacggaccgacaacggctggccggcgacgagaggatcag
atggttcccagcatgacctcctcgctggtcagagctgaaacagaactttcagcggatttt
gacaacagcatggacagtaggccggaggtgccgtcgcaggtgctcttccagcctcggatg
gaaagggaagaaacagtggacggcggcggtggcggcggaatggtcggcaggagcaacggc
ggcggccaccaaggccaacaccagcagcaacagcacaactttcagactacaattcaccgg
gcacggggcgttgcgccgtctacgtcagaggcatcaagcaactggactgggagagaaggc
ggcgtggtgcccgtctggtcgcctccggcagcgtcaggcccctcagatcactacgctgcc
gatgaagctgacattaccagtagaagttatttggacaggcatccacagtcgcatacgttg
atgaactggagtcagctctcgcagtcattgacaacaggctgggaagtggaaaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336008
Entry
4336008           CDS       T01015                                 
Name
(RefSeq) cryptochrome-1 isoform X1
  KO
K12118  cryptochrome 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4336008
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Cryptochrome_C TetR_C_21
Other DBs
NCBI-GeneID: 4336008
NCBI-ProteinID: XP_015636604
LinkDB
Position
4:22549877..22555039
AA seq 716 aa
MSVSSSSMGGGGGGDAGGRTVVWFRRDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGPY
YPGRVSRWWLSQSLKHLDASLRRLGAGKLVTRRSADAVVALLQLVRDTGATRLFFNHLYD
PISLVRDHRLKEMMAAEGIIVQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDP
AAPLLPPKRINSGDLSMCPSDDLIFEDDSERGSNALLARAWSPGWQNADKALTAFLNGPL
IHYSVNRKKADSASTSLLSPYLHFGELSVRKVFHLVRMKQLVWSNEGNRAAEESCTLFLR
SIGLREYSRYLSFNHPCSHEKPLLAHLRFFPWVINECYFKIWRQGRTGYPLVDAGMRELW
ATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGSLPDGRE
LDRIDNPQLEGYKFDPHGEYVRRWLPELARLPTEWIHHPWDAPASVLQAAGVELGSNYPL
PIVGLDAANARLQEALSEMWQLEAASRAAMDNGMEEGLGDSSEVPPIEFPRELQMEVDRE
PARVTANVLTTARRREDQMVPTMTSSLNRAETEISADFMNSVDSRAEVPTRVNFEPRTER
EENFRTTAGNVARTNGIHEHNNFQQPQHRMRNVLAPSVSEASSGWTGREGGVVPVWSPPA
ASDHSETFASDEADISSRSYLDRHPQSHRLMNWSQLSQSLTTGREVENSMQPNWIG
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgtcggtgtcgtcgtcgtccatgggcggcggcggtggcggggacgccggggggaggacg
gtggtgtggttcaggagggacctgagggtggaggacaacccggcgctggcggcggcggcg
cgcgccggcggggaggtggtgccggcgtacgtgtgggcgcccgaggaggacgggccgtac
taccccggccgcgtgtcgcggtggtggctcagccagagcctgaagcacctcgacgcctcg
ctgcggcggctcggcgccggcaagctggtgacgaggaggtcggccgacgccgtcgtcgcg
ctgctccagctcgtccgcgacaccggcgccacgcggctcttcttcaaccatctctacgac
ccgatctcactggtcagggaccaccggctgaaggagatgatggcagcggagggcatcatc
gtgcagtctttcaatgcagacctgctgtacgagccgtgggaagttgtcgacgacgaaggc
caatctttcaccatgtttgcgcctttctggaataggtgcctcagcatgccgtatgatcct
gccgcaccgctgttgcctcctaagagaatcaattcaggtgacttatcaatgtgcccatca
gatgatctgatctttgaggatgactcggagaggggaagcaatgcacttcttgcccgagca
tggtcaccaggctggcagaatgcagacaaggcactgacagctttcctgaatggtcctttg
atccactactcagtgaatcgcaagaaagcagacagtgcaagtacctccctcttatcaccg
tacctgcatttcggtgagctgagtgtgcgcaaggtcttccaccttgttcggatgaagcag
cttgtgtggagcaatgagggcaatcgtgcagctgaagagagctgcaccctgttccttcgg
tccattggtctccgggagtactcacggtatctgagtttcaaccacccatgcagccatgag
aagccccttttggcacacctcaggttcttcccctgggtgatcaatgagtgctacttcaag
atatggcggcagggaaggactggttacccccttgttgatgccggcatgagggagctatgg
gctacagggtggttgcatgatcgtattcgtgtggtagtgtcaagtttcttcgtcaaagtc
cttcaactaccatggcgatgggggatgaagtacttttgggacacattattagacgcagat
cttgagagcgatgcactaggctggcagtatatctctggctctcttcctgatggccgagaa
cttgaccgcattgacaatcctcagctcgaaggctacaagtttgatccgcatggtgagtat
gtccgaaggtggcttccggagcttgcaaggttgccaacagaatggatacaccatccatgg
gatgcacccgcatctgtgctgcaagctgcaggagtcgagttaggctccaactaccctctc
cctatagttgggctagatgcagccaacgccaggctgcaagaagccctgtcagaaatgtgg
cagcttgaggcagcatccagggccgcaatggacaatggaatggaagaaggccttggcgac
tcctcggaggttccaccaattgaatttcctcgagaactacagatggaagttgaccgagaa
ccagctcgagtaacagccaatgtgctgacaacagctcgaagacgcgaggatcagatggtg
ccaacaatgacatcttcactaaacagggctgaaactgagatttctgccgattttatgaac
agtgtggacagtagggcagaggtaccaacccgtgtgaattttgagcctcgaactgagcgg
gaagaaaatttccgtaccactgcgggaaatgttgctagaacaaatggtattcatgagcac
aataatttccagcaacctcagcaccgtatgcgaaatgttctagcaccatctgtatcagag
gcatcaagtggctggactgggagagagggaggcgtagtcccagtttggtcgcctcctgca
gcatcagaccattcagaaacttttgcctctgatgaagctgacatttctagtaggagttat
ttggataggcatccacagtcgcaccggttgatgaactggagtcaattatcccagtcattg
acaacaggtcgggaagtggaaaattccatgcaaccaaattggatcggttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270575
Entry
9270575           CDS       T01015                                 
Name
(RefSeq) cryptochrome-1 isoform X1
  KO
K12119  cryptochrome 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    9270575
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase
Other DBs
NCBI-GeneID: 9270575
NCBI-ProteinID: XP_015625483
UniProt: Q852P4 B9F161
LinkDB
Position
2:24915231..24922099
AA seq 651 aa
MAGSERTVVWFRRDLRIDDNPALASAARDGAVLPVFIWCPADEGQFYPGRCSRWWLKQSL
PHLSQSLESLGCPLVLIRAESTLEALLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELS
ALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDASPSLAPWKLVPVPGL
ESVRSCSVDDLGLESSKDEESSNALLMRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVE
GATTSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIGLREYSRYL
CFNFPFTHEKSLLGNLKHYPWKVDEERFKSWRQGMTGYPLVDAGMRELWATGWTHNRIRV
IISSFAVKFLLIPWTWGMKYFWDVLLDADLESDILGWQYISGSLPDGHELSRLDNPEVQG
QKYDPDGVYVRTWIPELARMPTEWIHHPWDAPSCILEVAGVELGFNYPKPIVDLHIAREC
LDDSISTMWQLDTAEKLAELDGEVVEDNLSNIKTFDIPKVVLRETSPCALPIDQRVPHAS
SKDHNLKSKVLKASNRSSICVDMIRSSKMEATSSVANSPVSRKRSFCETAFHVPSYSSSA
EVHSHIQDHGGSLVGPSRYLLQEAGRNYVDEVEDSSTADSGSSISRQRKAA
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggccggttcggagaggaccgtggtttggttcaggagggacctcaggatcgacgacaac
ccggcgttggcctccgcggcgagggacggcgctgtgctccctgtcttcatatggtgccct
gcggatgaagggcagttctatcccggccggtgctccaggtggtggctcaagcagtcgctc
ccccacctcagccagtcactggagtcgctcgggtgcccgctcgtgctgatccgagccgag
agtacccttgaggctcttctgcggtgcattgattctgtcggcgccaccagattggtttat
aatcatctgtatgaccctgtttctcttgtgcgtgatgacaaaataaaaaaagagctttcg
gcactgggaatttccatccagagttttaatggtgatctgctgtatgagccatgggaaatt
tatgatgatagtggacttgcatttacaacctttaacatgtactgggagaagtgcatggaa
ttacctattgacgcatcaccgtcacttgcaccttggaaattggtgcctgtcccaggtttg
gagagtgttcgtagctgttctgttgatgacctaggacttgaatcaagcaaggatgaggaa
tcaagtaatgctttgctaatgagggcctggtctcctggttggcgcaatgcagaaaagatg
cttgaagaatttgtctcccatggtctcctagaatactcaaaacatggaatgaaggttgag
ggagctactacatcattgctatcaccatatcttcattttggtgaggtgagtgtaagaaaa
gtatatcaacttgtaaggatgcaacaaatcaagtgggaaaatgagggaacatctgaagct
gaggagagcattcacttcttcatgcggtcaattggtcttcgagaatattcacggtacttg
tgttttaacttcccattcacacatgaaaagtcattgctggggaacttgaaacactaccct
tggaaagtagatgaggagcggttcaagtcctggaggcagggaatgacaggatacccattg
gtagatgctggcatgagggaactttgggctaccggatggacacataatcggataagagtt
atcatttcaagttttgctgtgaaatttctacttatcccatggacttggggtatgaagtat
ttttgggatgtgctattggatgctgatctggaaagtgatattcttggttggcagtacata
tctgggagcctgcctgatggccatgagctcagtcgtcttgataatccagaggttcaaggt
caaaagtatgacccagatggtgtatatgtaagaacttggatacctgaactagctagaatg
ccgacagaatggattcatcatccatgggatgcaccgagctgtattcttgaagttgctgga
gttgagctggggtttaactatcctaagccaatcgtagaccttcacattgctagggagtgt
ttagatgattccatctccacgatgtggcaattggatacagctgagaaacttgcagaatta
gatggtgaggttgtggaggacaacttgagcaatatcaagacttttgacatcccaaaagtt
gttttgagggaaacatctccatgtgctttgcccattgatcaaagagtgccccatgctagc
agcaaggatcataatttaaagtcaaaggtattgaaggcctcaaatagaagttctatttgt
gttgatatgatcaggtcctcaaagatggaagcaacgagctctgtagcaaactcaccggta
tcaaggaaaagatccttttgtgagactgcatttcatgtcccatcttattcatcttcagct
gaagtgcattcgcatattcaagatcatggtggttccttagttgggccttcaagatatctc
ctgcaggaagcaggtagaaactatgttgatgaggtagaagatagctctaccgcagatagt
ggttcgagcatttcaagacaacgaaaagccgcatag

DBGET integrated database retrieval system