KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329753
Entry
4329753           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4329753
   00052 Galactose metabolism
    4329753
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4329753
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4329753
NCBI-ProteinID: XP_015626682
UniProt: A0A0P0VKS3 Q69JW7
LinkDB
Position
2:22102425..22105103
AA seq 378 aa
MARAVLTLTVLAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGATIMSV
ILPDSKGNLADVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYRLFRNDGN
NSLHGGHRGFSKVIWTVKEHVAGGDSPRITLYYHSFDGEQGFPGDLDVFVTYELPRPYVL
AVRMNATARGKATPVNLAHHAYWNLAGEGSGAASVLAETVRIHASRYTPVDAATLIPTGR
VAPVAGTPYDFLAGAPVGARIVGAAVPGGAVSGYDTNYAVDGAAADGERRRLRPVAEVRD
GATGRAMEVWADQPGVQFYTSNGLAGVRGKGGRVYGRYGALCLETQGFPDAVNHPSFPSQ
IVRPGQVYEHNMVFKFTF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcaagagctgtgcttacactgactgttcttgccttcttgtgccttgtggccctcggc
ttgtccggcagagccaatgccaatgcaacggcggggaggaagatggttggggtgtatgag
ctgaagaagggggatttctccatcagggtcaccaactggggagctactatcatgtctgtg
attcttcccgactccaaagggaatttggctgatgtagtccttggctacgatacagttgct
gaatacgttaacgggacggcctacttcggaggactgatcggccgcgtagccaacaggatc
gccaacgcgcggttcacgctggacgggaagacctaccggctgttccgcaacgacggcaac
aactcgctccacggtggtcaccgtggattcagcaaggtcatatggacggtgaaggagcac
gtcgccggcggcgactcgccgcgcatcacgctgtactaccacagcttcgacggggagcaa
ggttttccgggcgacctggacgtgttcgtgacgtacgagctgccccgcccctacgtgctg
gccgtgcgcatgaacgcgacggcgcggggcaaggccacgccggtgaacctcgcccaccac
gcctactggaacctcgccggcgagggcagcggcgccgccagcgtcctcgccgagacggtg
cggatccacgcgtcgcggtacacgcccgtggacgccgcgacgctcatcccgacggggcgg
gtcgcgcccgtggccggcacgccctacgacttcctcgccggcgccccggtgggcgcgcgc
atcgtcggcgccgccgttcccggcggcgccgtctccgggtacgacaccaattacgccgtg
gacggcgccgcagccgacggcgagcggcggcggctccggccggtggcggaggtccgcgac
ggcgcgacggggcgggcgatggaggtgtgggcggaccagccgggggtgcagttctacacg
agcaacgggctcgccggcgtgcgcggcaagggcgggagggtgtacggccggtacggcgcg
ctgtgcttggagacgcaggggttccccgacgccgtgaaccacccgagcttcccgtcgcag
atcgtccggccggggcaggtgtacgagcacaacatggtgttcaagttcaccttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332976
Entry
4332976           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332976
   00052 Galactose metabolism
    4332976
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4332976
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4332976
NCBI-ProteinID: XP_015630178
UniProt: Q75M64 A3AIJ3
LinkDB
Position
3:complement(15100581..15102437)
AA seq 376 aa
MAATSARSVAWQWLAVAAAVAAASLIGGTPAEARRGGKESIGFYELRRGEFSVVVTNWGA
TILTVNLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALVGRVANRIAGGRFTVKGHAFHTY
KNDGKNTLHGGHRGFNQVFWSVRERATGHFPYITFYYRSYDGEQGFPGALDVLVTYKIDG
DYSFSVTMYARPVDDGKPTPVNLAQHTYWNLRGHGNGTILDHSVQIFASAVTPVGAGLIP
TGAVSPVSGTPFDFRAPAPPGARIADVPGGGYDINYVLDGEADGQGVRKAAVVSEPTSGR
VLELWSDQPGLQFYTGNFLKGDEGKGGARYVKHGGLCLETQDYPDAVHNAKFPTEIYRKG
QEYKHYMLYKFSLAKK
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggcgacgagcgccaggagcgtggcgtggcaatggttggccgtggcggcggcggtg
gcggcggcgtctctgatcggcggcacgccggcggaggcgaggaggggagggaaggagtcc
atcggtttctacgagctgcgtcggggcgagttctccgtcgtcgtcaccaactggggcgcc
accatcctcaccgtcaacctccccgacaagaacgggcacattgatgacgtcgttcttggc
tacaaagatattggatcttacgtgaatgacacgacctacttcggggcgctggtggggcgg
gtggcgaaccggatcgccggcgggaggttcacggtgaaggggcatgcgttccacacgtac
aagaacgacggcaagaacacgctccacggcggccaccgcgggttcaaccaggtgttctgg
tcggtccgggagagggccaccggccacttcccctacatcaccttctactaccggagctac
gacggcgagcagggcttcccgggcgccctcgacgtgctcgtcacctacaagatcgacggc
gactactccttcagcgtcaccatgtacgcccgccccgtcgacgacggcaagcccacgccg
gtcaacctcgcccagcacacctactggaacctccgcggccacggcaacggcaccatcctc
gaccactccgtccagatcttcgcgtcggcggtcacccccgtcggcgccggcctcatcccc
acgggagccgtctcgcccgtctccggcacgccgttcgacttccgcgcccccgcgccgccc
ggcgcgcgcatcgccgacgtccccggcggcgggtacgacatcaactacgtgctcgacggc
gaggccgacgggcagggcgtgcgcaaggcggcggtggtgagcgagcccacctcggggcgc
gtgctggagctgtggtccgaccagcccgggctgcagttctacacgggcaacttcctcaag
ggcgacgagggcaagggcggcgcgcgctacgtgaagcacggcggactctgcctcgagacg
caggactacccggacgccgtccacaacgccaagttccccaccgagatctaccgcaagggc
caggagtacaagcactacatgctctacaagttctctctcgccaagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336037
Entry
4336037           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336037
   00052 Galactose metabolism
    4336037
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4336037
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4336037
NCBI-ProteinID: XP_015636913
UniProt: A0A0P0WB27
LinkDB
Position
4:22893711..22898671
AA seq 380 aa
MARPAPLLLLLAAVCLVAAASAGGADAAERKATTVGVYELRKGDFSIRVTNWGAVIMSVV
LPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVANRIAKARFVLDGKAYHLYPNDGKN
TLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDGEQGFPGALDVYVTYQLSGPYVLS
VHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNTVQLFASRYTPVDAELIPTGQVAPV
TGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALRRVTVVR
DGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVNHPNFP
SVIVRPGQVYKHEMVYKFSF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggctagaccagctccgctgctgcttcttctcgcggcggtgtgcctagtggccgccgcc
tccgccggcggtgccgatgcggcggagaggaaggcgacgacggtcggcgtctatgagctc
aggaagggagatttctccatcagggtcaccaattggggagcggtcatcatgtccgtcgtg
cttcctgactccagagggaaattggacgatgttgttcttggatatgacaccattgctgaa
tatgttaattcttctacttactttggagcgctcgtcggacgggtagccaacagaattgcc
aaggcgcggttcgtgctcgatggaaaagcttatcatctgtatccaaatgatggcaaaaac
acacttcacggtggtcacaggggtttcagcaatgttacatggacagtgaaggagcatgtt
ggtggaggtgacgcaccatacatcacactgtactaccatagctttgacggagaacaagga
ttcccaggcgccctagacgtgtacgtgacgtaccagctgtccggcccgtacgtgctgagc
gtgcacatgaacgcgacggcggcgggcaaggcgacgccggtgaacctggcgcagcactcg
tactggaacctcggtggcacgggcagcggcgacatcctgggtaacacggtgcagctgttc
gcgtcgcggtacacccccgtggacgccgagctcatcccgacgggccaggtcgcgcccgtc
accggcacgccctacgacctccgcgcgccgacgcccgtgggcgcgcgcgtccacctggtg
acgggcggcctcagcaagacgggcgccaccatctacggcttcgacaccaactacgccgtg
gacggcggtgacgacgtcgacgcgcacgcgcacgcgctgcggcgggtgaccgtcgtccgg
gacggcaagtccgggcggtcgctggagctgtgggcgaaccagcccggggtgcagttctac
accggcaacttcctcacggccgacgtgaaggggaagggcgggaaggcgtacgggcagtac
ggcgcgctgtgcctggagacgcaggggttccccgacgccgtgaaccaccccaacttcccg
tcggtgatcgtgaggcccggacaggtgtacaagcacgagatggtgtacaagttctcgttc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336039
Entry
4336039           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336039
   00052 Galactose metabolism
    4336039
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4336039
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4336039
NCBI-ProteinID: XP_015634243
LinkDB
Position
4:22901503..22905666
AA seq 438 aa
MKGSDQSKRSHASTRAAQVSVRNQAGPVPPRTNSSEIAAGIRLYLHLYQETIENELHASL
SSRPVSCPRRIALLTMAGARLSLAFLCFVVVVVASALAGGAGARKTVGEYVLRKGDFSVK
ITNWGATMMSVVLPDSKGNLADVVLGLDTIAEYVNDTNYFGPVTGRVGQRIARGRFVLDG
KVYHTYINDGRNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDGEQGFPGDLDAY
VTYQLSSPYVLALRMNATALNKATPVNFLQHTYWNLGGQGRGDVLGHTLQLSASRYTPLD
EELLPSSGVVAPVAGTPYDFRHPTPIGARIRQVMGGRIAGYDINYVIDGEGMRKVAAARD
GASGRALELWANQPAMQLYTGNWLNNIKGKGGKVYQQYGGFCLETQGYVDAVNHPEFPSM
TVRPGQVYRHDMAFKFSF
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaaaggatcagatcaatcaaaaagatcacacgctagcacgcgcgcagcgcaggtgtct
gtccgtaaccaggctggtccggtcccgcctcgaacaaactcgtccgagatcgcggccggt
atccgcctatatctacatctatatcaggagaccatcgagaatgagttgcatgcatccctc
tcctctcgtcctgtgagttgcccaagacgaatcgctttgctcacaatggctggagctcgg
ttgtctctcgcgttcctgtgctttgtggtggtggtggtggcctccgcgctcgccggcggc
gccggtgcgaggaagacggtcggcgagtacgtgctcaggaagggggacttctccgtgaag
atcaccaactggggagcaaccatgatgtcggtcgtcctccctgattccaaagggaatttg
gctgatgttgtgcttggcctagacaccattgctgagtacgtgaacgacactaattacttc
gggccggttaccggacgggtcgggcagaggatagccagggggcggttcgttctcgacggg
aaggtgtatcacacgtacatcaacgacggcaggaacgcgattcacggtggacacagaggg
ttcagcaaagtcatatggacggtgaaggagtacgtcggcggcggcgactcgccgtacatc
accttgtactaccgcagcttcgacggagagcaaggtttccccggggacctggacgcgtac
gtgacgtaccagctgtcgagcccgtacgtgctggcgctgcgcatgaacgcgacggcgctg
aacaaggcgacgccggtgaacttcctgcagcacacgtactggaacctcggcgggcagggc
cgcggcgacgtgctggggcacacgctgcagctgtcggcatcccggtacaccccgctggac
gaggagctcctcccgtcgtcgggcgtcgtcgcgcccgtcgccggcacgccctacgacttc
cggcaccccaccccgatcggcgcgcgcatccggcaggtgatgggcgggcgcatcgccggg
tacgacatcaactacgtgatcgacggcgagggcatgcggaaggtggccgcggcgcgggac
ggcgcgtcgggccgcgcgctggagctgtgggcgaaccagccggccatgcagctgtacacc
ggcaactggctgaacaacatcaagggcaagggcggcaaggtgtaccagcagtacggcggg
ttctgcctggagacgcaggggtacgtggacgccgtgaaccacccggagttcccctccatg
acggtcaggcccggccaggtgtacaggcacgacatggccttcaagttctccttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346383
Entry
4346383           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4346383
   00052 Galactose metabolism
    4346383
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4346383
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-GeneID: 4346383
NCBI-ProteinID: XP_015610680
LinkDB
Position
9:817549..823555
AA seq 439 aa
MEQLVGVHHHHSSSSSLSPRTPSPTHPLPHLLRLPSSSNRLRPPDHPHSSHPVSKLLRVT
PPFFLVLLAAVYLLASFTIFSSPAASLRPTKNRPKLLLPMPAPSPPPPDLFELHGGRIRA
WITNVGATVTSLLVPDNNGVLGDVVLGFDSLDPYQNGTSPYFGCIVGRVANRIKDGKFTL
NDKQYSLAINNPPNTLHGGFKGFDKIIWEVAEYVKGENPSITFKYYSKDGEEGFPGDVSV
TARYSILASTTLKLEMEAIPLNKATPISLAQHTYWNLAGHNSGDVLAHTVQILGSQITPV
DETSIPTGEMMPVSGSPFNFLTETTIGSRIDQVPGGYDHNFVIDCGEVKSGLCHVAKVTD
PSSSRVLDIWADAPGVQFYTGNFLNGIVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSV
VVQPGEKYSHTMLFEFSTK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggagcagcttgtgggagttcaccaccaccattcttcttcctcctccctctccccgcgg
actccatctccaacccacccactcccgcatctcctgcgcctcccttccagctccaaccgg
ctccgcccaccggatcacccccactcctctcatcctgtctccaagctcctccgcgtcacc
cctcccttcttccttgtcctcctcgccgccgtctacctcctcgcctccttcactatcttc
tcctctcccgctgcctcgctccgccccaccaagaaccgccccaagctcctcctccccatg
cccgccccctctccccctccccccgacctctttgagctccacggtggcaggatccgggcc
tggatcaccaatgtcggcgccaccgtcacctcgctcctggtcccagataacaatggggtt
cttggtgatgtggtgcttggattcgattccctggatccttatcagaatggcacttcacct
tattttggctgcattgttgggcgagttgcaaataggatcaaggatgggaagtttacttta
aatgataagcagtatagtctggctatcaacaaccctccaaacactcttcatggtggattt
aaaggttttgacaaaatcatctgggaagttgctgaatatgtcaaaggggagaacccatca
atcaccttcaaatattacagtaaagatggagaggaaggtttcccaggagatgtttctgtc
accgctagatattctattctggcaagtacgacactgaagttggagatggaggctatacct
ttgaataaggccacacccatcagtttagcacagcacacctactggaacctggcaggccac
aactcaggagatgtgcttgcacatactgttcagattttggggtctcagataacaccggta
gatgaaacctcaatacccaccggtgagatgatgccagttagtggctcacccttcaatttc
ctgacagagaccacaattggcagcaggattgatcaagtccctggtggctatgatcacaac
tttgtgattgattgtggtgaagtgaagtcaggtttgtgccatgtggcgaaagtgacagac
ccttcaagctccagggtccttgacatttgggcagatgcacctggagtgcagttctacact
ggaaatttcctcaatggcattgtgggcaaaggaggcgcagtctatgggaagcacgccggc
ctgtgtcttgagacccaaggtttcccaaacgcagtgaaccaacctaattttccctcggtg
gtcgttcagcctggtgagaagtatagtcatacgatgttgtttgagttttcaacaaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348138
Entry
4348138           CDS       T01015                                 
Name
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348138
   00052 Galactose metabolism
    4348138
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4348138
SSDB
Motif
Pfam: Aldose_epim YscW
Other DBs
NCBI-GeneID: 4348138
NCBI-ProteinID: XP_015614365
UniProt: Q33AZ5 Q0IYV9
LinkDB
Position
10:complement(3475573..3478231)
AA seq 362 aa
MRCLIASSSRDKTESDFSESRQVRLAVAAMAAEEILELSNGRITAKIAAWGATITSLIVP
DAHGNLADVVLGFDTLEPYMKGISPYFGCIVGRVANRIKEGKFTLNGVEYSLAINNGPNS
LHGGLKGFDKVVWDVVERKSECPSITFQYHSKDGEEGYPGDVTVRATYSLPDSTTLRLDM
EAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDENTIPTGEIMPVKGT
PFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKHAAKLKDSSNSRTLDLWTDAPGM
QFYTANYVDGVTGKGGAVYGKHSGVCLETQGFPNAINQPNFPSVVVQPGEKYKHTMLFEF
SA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgttgcttgattgcttcatcttcacgtgataaaaccgaaagcgacttctccgagtct
cgtcaggtcagactcgcagtcgcagcaatggcggccgaggagatcttggagctctccaat
ggccgcatcaccgccaagatcgccgcctggggcgccaccatcacctccctcatcgtcccc
gacgcccacgggaatctcgcggatgtggttcttggattcgacactctggagccttacatg
aaaggcatatcaccttattttggatgcattgttggccgtgttgcaaataggatcaaggag
ggaaagtttactctgaatggagttgagtattcactagctatcaataatggacccaacagt
cttcatggtgggttgaaggggtttgacaaagtagtgtgggatgtagtagagcgcaaaagt
gaatgcccatcaatcaccttccaatatcacagcaaggatggggaagagggctaccctggc
gatgtgactgttcgagcaacatactctcttcctgattctaccaccttaagacttgacatg
gaagcagtagcagagaacaaagcgacgcccatcaacttggcgcagcacacctactggaac
ctggcagggcacaactccggtgacaccttggatcattcaatccagatctggggaaaacac
ataactccagttgacgagaacacgattcccaccggtgagataatgcctgtcaagggcaca
cctttcgacttcacaacagagcacaagattggagcccgcatcaacgatgtgcctggagga
tatgaccataactatgtgctggactctggcgaagagaagaatggcctgaagcatgctgcc
aagctgaaagattcatcgaactcacggaccctggacctctggactgatgcacctggaatg
cagttctacactgctaactatgtggatggcgtaactggcaaaggtggtgccgtttatggg
aagcattccggagtatgcttggaaacccaggggtttcctaatgccatcaaccaacccaat
ttcccctccgtggtggtgcagcctggtgagaagtataagcacactatgctgtttgagttc
tcagcctaa

DBGET integrated database retrieval system