KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329760
Entry
4329760           CDS       T01015                                 
Name
(RefSeq) beta-1,3-galactosyltransferase 15
  KO
K14413  beta-1,3-galactosyltransferase [EC:2.4.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4329760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329760
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     4329760
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4329760
SSDB
Motif
Pfam: Galactosyl_T Gal-bind_lectin Fringe
Other DBs
NCBI-GeneID: 4329760
NCBI-ProteinID: XP_015626902
UniProt: A0A0P0VKS6
LinkDB
Position
2:22175947..22178701
AA seq 627 aa
METALQMWVTKRLGITVLIVLFPLLIVHHLIVNSPVSGPSRYQVIHSNLLGWLSDSLGNS
VAQNPDNTPVEVIPADASASNSSDSGNSSLEGFQWLNTWNHMKQLTNISDGLPHANEAID
NARTAWENLTISVHNSTSKQIKKERQCPYSIHRMNASKPDTGDFTIDIPCGLIVGSSVTI
IGTPGSLSGNFRIDLVGTELPGGSGKPIVLHYDVRLTSDELTGGPVIVQNAFTASNGWGY
EDRCPCSNCNNATQVDDLERCNSMVGREEKRAINSKQHLNAKKDEHPSTYFPFKQGHLAI
STLRIGLEGIHMTVDGKHVTSFPYKAGLEAWFVTEVGVSGDFKLVSAIASGLPTSEDLEN
SFDLAMLKSSPIPEGKDVDLLIGIFSTANNFKRRMAIRRTWMQYDAVREGAVVVRFFVGL
HTNLIVNKELWNEARTYGDIQVLPFVDYYSLITWKTLAICIYGTGAVSAKYLMKTDDDAF
VRVDEIHSSVKQLNVSHGLLYGRINSDSGPHRNPESKWYISPEEWPEEKYPPWAHGPGYV
VSQDIAKEINSWYETSHLKMFKLEDVAMGIWIAEMKKGGLPVQYKTDERINSDGCNDGCI
VAHYQEPRHMLCMWEKLLRTNQATCCN
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggaaacggcactgcagatgtgggtgacaaagcgactcggaattacggttctaatcgtc
ctcttccctctgctgattgtgcatcatctgatagtgaatagcccagtgtcagggccatct
cgataccaagtcatacattctaatctccttggttggttgagcgactcattgggaaattca
gtggctcaaaatccagataatacaccagtagaagtgataccagcagatgcttcagcttca
aacagctcggattccggaaattcctctcttgaaggatttcagtggttaaatacatggaat
cacatgaagcagttgaccaacatctccgatggccttcctcacgcaaatgaggctatagac
aatgcaagaactgcatgggaaaacctgacgatatcagttcacaattcaacctctaaacag
attaagaaagagaggcagtgtccatattctatccacagaatgaatgcctccaagccagac
actggagattttaccatcgatataccttgtgggctgattgtaggttcttcagtaactatt
ataggcactccaggtagcctctccggtaacttcaggattgatcttgttgggacagaattg
ccagggggatctgggaaacccatcgtactgcactatgatgttcgtctaacaagtgatgaa
cttactggaggtccagtcatagtgcagaatgccttcactgcaagtaatggctggggttat
gaggatagatgtccctgcagtaactgtaataatgcaactcaagtggatgatttggagcga
tgtaattccatggtgggtagagaagagaagagagctataaactcaaaacagcacctgaat
gccaagaaagatgaacacccaagcacatattttccatttaagcagggacaccttgctatc
tcaactcttcggatagggctagaagggattcacatgacagttgatggaaaacatgttacc
tcatttccatataaagcgggcttggaagcatggttcgttactgaagtaggagtatctggt
gatttcaagctagtaagtgcaattgcaagtggcctgcccacatcagaagacctggagaac
agcttcgatcttgcaatgttgaagtcgtcacctattccagagggaaaagatgtggacctt
ttgattggtatcttttcaacagcaaacaacttcaaacgaaggatggcgatccgacggaca
tggatgcaatatgatgcggtgcgcgaaggagcagtagtggtccgttttttcgttggcctg
catacaaacctcattgtaaacaaggaactctggaatgaagcacgcacatatggcgacatt
caagtgctgccctttgttgattactacagtctgataacatggaagacactggcaatatgc
atctacgggactggtgctgtatcagcgaaatatctgatgaaaacagacgatgatgctttt
gtccgtgtggacgagatacactcctcagtaaaacaactgaatgtcagtcacggcctactt
tatggtcgtatcaattctgactcaggtcctcacagaaatcctgagagcaaatggtacata
agcccagaggaatggcctgaagagaaatacccaccatgggcacacggaccaggatatgtg
gtatcacaagacattgcaaaggaaatcaacagttggtatgaaacaagtcatttgaagatg
ttcaaactagaagatgtagcaatgggtatatggattgctgaaatgaagaagggtgggtta
cctgtccaatacaaaacagatgaaagaattaacagtgatggctgcaatgatgggtgcatc
gttgctcactaccaagaaccaaggcacatgctatgcatgtgggagaaactcctaaggaca
aatcaagcaacgtgctgcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340564
Entry
4340564           CDS       T01015                                 
Name
(RefSeq) beta-1,3-galactosyltransferase 15
  KO
K14413  beta-1,3-galactosyltransferase [EC:2.4.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4340564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4340564
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     4340564
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4340564
SSDB
Motif
Pfam: Galactosyl_T Gal-bind_lectin
Other DBs
NCBI-GeneID: 4340564
NCBI-ProteinID: XP_015643845
UniProt: A0A0P0WUE8
LinkDB
Position
6:6715891..6721974
AA seq 637 aa
MKKWHGGFVIVSLFIILMLRYVILDSPLAEKSLQYVFQQNNTTPLHWLDVPNPPAVQNPQ
NISQVISTELLASNLSITRNFSDRELQSLHSWNHLKDLVSHAHILPDGVEAIKEAGVAWR
ELNAALEYDESAVSVNGSTHQKSKEKQCPYSIRRMNATRSGDRFVLKIPCGLIQGSSITI
IGTPGGLLGSFKIELTGATVPGEPDPPIVLHYNVRLLGDKLTEDPVIVQNTWTIADDWGS
EDRCPSPGSDAKDIAKVDELEKCGSMVGNDQKQAWATKLKSNVSSIQPAWKKNTEPKKYF
PFRQGYLAIAILRVGAHGIHMTVDGKHVTSFAFREDLEPGFVGEVRIAGDIKLLSVIASG
LPTTEDFEHVTDLEILKAPPVPMDKPLDLFIGIFSTANNFKRRMAVRRTWMQYDAVRSGK
AAVRFFVGLHKNEVVNEELWNEARTYGDIQLMPFVDYYSLILWKTIAICIYGTNVLSAKY
VMKTDDDAFVRVDEILLSLDRVNISHGLLYGRVNSDSQPHRDPYSKWYITPEEWPEESYP
PWAHGPGYIVSQDIAKEVYRKHKRGELKMFKLEDVAMGIWINEMKKDGLDVKYENDGRIL
VEGCEEGYVVAHYQEPRDMMCLWDKFLKTKRGTCCKE
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagaaatggcacggtggttttgtcatagtatctttgttcattatattgatgctaaga
tatgttatattggatagtccacttgctgaaaaatctcttcagtatgtcttccaacagaat
aacacaaccccactacattggctggatgttccaaacccgcctgcagttcagaatccacag
aacatctctcaagtaatatcaactgaattgttagcttcaaacctttccataacaagaaat
ttctccgatagagaactgcagtcattgcattcttggaatcatttaaaagacctagtaagt
catgcgcacatcttaccagatggagtagaagcaatcaaggaagctggagtagcatggagg
gagctaaatgcagcccttgaatacgatgaatctgctgtttctgtcaatggtagcactcat
caaaaaagtaaagagaagcaatgcccatattccattcgaagaatgaatgctacaagatca
ggtgatagatttgtcttaaagattccttgtggactgattcagggctcttcaataactatt
atcggtactcctggtggtcttcttggtagttttaagatagaattaactggggctactgta
cctggtgaaccagaccctccaattgtgcttcattacaatgtccgtcttcttggtgataaa
cttacagaagatcctgtaatagtccaaaatacatggactatagctgacgactggggttct
gaagatcgttgcccatctcctggttcagatgctaaggacattgcaaaagtggatgagtta
gaaaaatgcggtagcatggtgggcaatgatcaaaaacaagcatgggccactaagttaaag
tccaatgtttcaagcatacaacctgcctggaaaaagaacacagaacctaagaaatatttt
cccttcagacaaggatatcttgctatagcaattcttcgtgttggagcacatgggatccat
atgactgtagatgggaaacatgtcacttcatttgcctttcgggaggatttggagcctgga
tttgttggtgaagtaagaattgcaggagatattaaattgttgtctgtgatagcaagtggt
ttgcctacaacagaggactttgaacatgtgactgacttagaaattttgaaggctccacca
gttcccatggacaaacccctggatctttttattgggatcttttctacagctaacaatttc
aagcgcagaatggcagttcgcagaacttggatgcagtatgatgctgtccgctcaggaaag
gctgcagttcgattctttgttggcctgcataaaaatgaggtggtgaatgaggaactttgg
aatgaagcacgaacatatggagacatccaattgatgccctttgttgattattatagcctg
attctatggaagactatagccatctgcatctatgggacaaacgtcttgtcagccaagtat
gtgatgaaaacagatgatgatgcttttgtccgtgtggatgagatacttttatctttagat
cgcgtgaacatcagtcatgggttactgtacggtcgtgtcaattctgattctcagcctcat
cgagacccatatagcaagtggtacataaccccagaggaatggcctgaggagagttatcct
ccatgggcacatggtccgggatacattgtatcacaagacatagcaaaagaagtttacagg
aaacacaagagaggagaacttaagatgttcaaactagaagatgtcgcaatgggaatatgg
atcaatgagatgaagaaggatgggttggatgtaaagtatgaaaatgatgggaggattttg
gtcgaaggctgtgaggaaggatatgtggttgcacattaccaggagccaagggacatgatg
tgcctatgggacaaatttctgaaaacaaaacgaggaacatgttgcaaggagtaa

DBGET integrated database retrieval system