KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329786
Entry
4329786           CDS       T01015                                 
Name
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / o-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329786
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     4329786
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     4329786
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     4329786
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     4329786
SSDB
Motif
Pfam: Abhydrolase_6 TPP_enzyme_N TPP_enzyme_M_2 MR_MLE_C Abhydrolase_1 Hydrolase_4 TPP_enzyme_C Abhydrolase_2 Ndr Thioesterase BAAT_C Abhydrolase_11 DLH Abhydrolase_3 DUF900 Mbeg1-like Esterase LIDHydrolase TPP_enzyme_M Abhydro_lipase Ser_hydrolase
Other DBs
NCBI-GeneID: 4329786
NCBI-ProteinID: XP_015626291
UniProt: F7VJK0
LinkDB
Position
2:22415270..22429837
AA seq 1712 aa
MLAVVFSSGHRLLPLPVLPGTFTTPPPPPPPPLLSPRRPLLAPRRRRCLCGGGGGGLLLL
RAVAARRAGIVIDVDEVGEVGDRDLPVDVSFTRRLPPVLTLGDGLAALRRAGEEVKACPP
AAAASGVIRFEVLVPPSTKALKWLCTQFKRSSLFPQFYLSRKQTTDSSIQLEISGAGSAI
CFHGSSRVDNGFDLISRYLSFNSHLIRAYGSVGVKYDKELLSLEERIGSFYFFIPQVELS
EFDGYSMLSSTIVWDDSVSHTFEDSVCLFESCFSQIWSSYDSSATICYENMVTSYIGESR
MSESRNTQLVYLDAEFLAVIDGKAVTEKENCPTSDQSFVRFSPQFLFCANMDLCLQSNKI
ESFIRRCSNINLAWASFIVEEFVRLGFTYFCIAPGSRSSPLALSASVHPLTTCISCYDER
SLGFHALGYGRGSRKPAIVITSSGTAVSNLLPSVVEASQDFVPLILLTADRPPELQDVGA
NQAINQVNHFGSFVRHFFSLPPPDDHIYARMVLTTVDSAAYYAMQAPQGPVHINCAFREP
LDYGYQDWSVDCLKGLDKWFINREPYTRYLGMKMVSALGNYSCSVREVLEIVKNANQGLL
LVGAIHTEDDIWAVTLLARHLSWPIAADVLSGLRMRKVQKSIPGLDKSICFIDHIDQILL
SESVKSWKTPDVIVQIGSRITSKRVGTYLESCSPSSYILIDAHPCRHDPSHVVTHRIQAT
ITEFAASLCQCNFQTKTSRWSDILMVLNSAVSQEIMFQVHSECSLTEPYVAHVIGEALYG
DATMFIGNSMVIRDLDMFGKGWIDHSTNANNAMMHHFPGFLGAPVAGNRGASGIDGLLST
SIGFAIGSNKHVFCVIGDISFLHDTNGLSLLNQRTQRKPMTVIVINNHGGAIFSLLPVAK
TASLQILEKFFYTLHDISISKLCAAHRIKHILVQTKAELHDALVKSHEGHVDCVVEVENR
IVDNANFHRIISMFTDHSATMHLAYLLGGPYCKDGVNGFSVGRIHAAEYMFYRIQLAAPR
TSGISESSFFHEGFILKLCVGDSIVGFGEVAPIEIHEEDLLDVEEQLRFLFHRMKDAELD
VVPLLRGSFSNWIWTTLGIPPSSVFPSVKCGLEMAILNLLESQRIDRSYGIFTGSNVVEY
NQSSTANIQICALVDSCGTPMDVTLAVVKLVAEGFTTVKLKVGRRENPAEDAAVIQKVRE
IVGYKINIRADANRKWTYEQAIDFGSRVKGLCLQYIEEPVDSVNDIIKFCENSGLPVALD
ETIDNLTGDVIPKLHQFSHPGIVALVIKPSVVGGFETAAYIAKWAHMHDKMAVISSTYES
SVGLATYIQFAHYVDRQNDITSRIKNRGSCGNVAHGLGTYQWLREDVSDQKLKIHAPPLG
DGIRASAEDAHGYLQHLVINDKKIERTYSEEKLRSYFIQVDGDNFSYQVKLQEGGDCTHE
KVILFLHGFLGTSEDWVPMMKALSPSARVIAVDLPGHGESEILQHDVENSNQISFSVQSV
ADLLLKLIRNITDGAVVVVGYSMGARIALHMALNQNHKISGAVIISGSPGLRDEASKRRR
SAIDRSRAHFLSSCGLENFLETWYSAKMWASLREHPKFDSLVRTRMKHNNIKALSKVLAD
SSIGTQKSLWEDLKHLKSPLLIVAGEKDPKFKEISQQMCREIRKHKDRESDGLCEMIIIP
DSGHAVHVENPLPLVRAIRKFLVRDIPDVISK
NT seq 5139 nt   +upstreamnt  +downstreamnt
atgctcgccgtcgtcttctcctccggtcaccgcctcctccccctccccgtcctccccggc
acattcaccacccctcctcctcctcctcctcctcctctcctatcccctcgccgtcctctg
ctcgcccctcgccggcgccgctgcctatgcggcggcggcggtggcggcctcctcctcctt
cgcgccgtcgccgcgaggcgcgcgggcatcgtgatcgacgtcgacgaggtgggcgaggtc
ggcgaccgcgacctccccgtggacgtgtcgttcacccggaggctgccgccggtgctcacc
ctcggggacggcctcgccgcgctgcggcgggccggggaggaggtgaaggcctgcccgcct
gccgccgccgcgagcggcgtcatccggttcgaggtgcttgttccacccagtacgaaggcg
ctcaaatggctgtgcacacagtttaagagatcatcattgtttcctcagttttatttgtcg
aggaagcaaaccactgattcatcaattcagcttgaaatctctggcgctggctctgcaatt
tgctttcatggttcctctcgagtagataatgggtttgatttgatatcaagatatctttcg
tttaattcacacttgattagagcctatggatcagtaggtgttaaatatgacaaggaacta
ttgtctttagaggagagaattggttcattttacttctttattcctcaggttgagctgagt
gaatttgatggctattccatgttatcgtcaactattgtttgggatgactccgtgtctcac
acatttgaggattctgtttgtttatttgaatcttgtttcagtcagatatggagtagctat
gattcttcagctactatctgttatgaaaacatggtaacaagttacattggagaatcgcgt
atgtcagagagcaggaatactcagttggtatacttggatgctgaatttctcgctgtaata
gatggcaaagctgtcacggaaaaggagaattgcccaacttctgatcagtcatttgttcgg
ttttcgccgcagttcttgttttgtgcaaacatggatttatgtttgcaaagcaacaaaatt
gaatctttcattaggagatgctctaacattaatttggcatgggcatccttcatagttgaa
gaatttgtcaggcttggttttacgtacttctgtatagctccagggtcgagatcatcccca
cttgcactttctgcttcagtccatcctttgacaacctgcatatcatgttatgatgagcgt
tcacttggatttcatgctcttggctatgggagaggttctcggaagcctgcaatagtaatt
acatcatcaggaactgctgtatcaaatctccttccttcagtggtggaggcaagtcaagat
ttcgtaccacttattttactcacagctgatcgtcctcctgagctgcaggatgtaggagcc
aaccaagccatcaatcaggtaaatcattttggcagttttgtaagacacttttttagtctc
cctccaccagatgatcatatttacgcgagaatggttcttacaacagttgattcagcagcc
tactatgccatgcaagcaccacaagggccagtgcatataaactgtgcttttagagaacca
ctagactacggatatcaagattggagtgttgactgtttgaaagggttggacaaatggttt
ataaatagagaaccatacactagatacctaggaatgaaaatggtttctgcattaggtaac
tattcttgttcagtaagggaggttctggagattgtaaagaacgcaaaccaggggctttta
ttagttggtgctattcacacagaagatgatatctgggctgtgactttactagctagacac
ctttcctggccgattgctgctgatgttctgtctggattgcgaatgaggaaagtacagaaa
tcaattccaggactagataagagcatttgttttatagaccacatagatcaaattctactg
tctgaatctgttaaaagctggaaaactccagatgttattgtccagattggaagccggatc
actagcaaacgagtgggaacatatcttgagtcctgctccccgtcttcttacatcttaatt
gatgcacacccatgccgccatgatccttcacatgttgtcactcacagaatccaggctact
ataactgaatttgctgctagtctgtgccagtgtaatttccaaacaaagacaagcagatgg
tcagatattttaatggttctgaattcagcggtttcacaggagataatgtttcaggtgcat
tcagaatgttcacttacagaaccatatgttgctcatgtaattggagaagcactttatggc
gatgctactatgtttattgggaatagcatggtcattcgagacttggatatgtttggcaag
ggctggattgaccatagtacaaatgcaaataatgctatgatgcaccattttccaggcttt
cttggtgcaccagtagctgggaacaggggagcaagtggtattgatggtttgcttagtaca
tcaattggatttgccattggatcaaacaagcatgtattctgtgtgattggtgacatatct
tttcttcatgataccaatggattgtcacttctgaaccaaaggacgcagaggaaacccatg
acagtaattgtcattaacaaccatggtggtgcaatcttcagccttctaccagttgcaaaa
acagcttcactccaaattttggagaaatttttctacaccttgcatgacatatcgatttcc
aaactctgtgctgcacacaggataaaacatattctagttcagacaaaagctgaacttcat
gatgccttagtgaagtcccatgaggggcatgttgattgtgttgtcgaagtggagaatcgc
attgttgataatgccaactttcatagaattataagcatgttcacagaccatagtgcaacc
atgcatctggcatatcttctgggaggtccatattgtaaggatggggtaaatggcttttct
gttggtagaatacatgcagcagaatacatgttttacaggatccaacttgctgcaccacgt
acatctgggatatcagaaagcagcttctttcatgaaggtttcatactaaagttatgtgtg
ggtgacagcattgtgggattcggcgaggttgcaccaattgaaattcatgaggaggatctg
ttggatgttgaagaacagcttaggtttctctttcacagaatgaaagatgctgagctagat
gttgttcctttgttgagaggatccttctccaattggatatggacaacccttgggattcct
ccttcttcagtattccctagtgttaagtgtggtctagagatggctattcttaatttgctg
gagtcacaacgaatagatagatcctatggtatttttactggctccaatgtggtcgaatat
aatcagagcagcactgcaaacatacagatatgtgcactcgtagactcctgtggcactcca
atggatgtaacacttgctgttgtcaaacttgttgctgaaggtttcaccaccgttaaactg
aaggttgggcgtcgcgaaaatcccgctgaagatgcagctgttattcaaaaagtaagggaa
attgtaggatacaagatcaatatccgtgctgacgcaaataggaaatggacatatgaacag
gcaattgattttggatccagggtaaaaggcttatgtttgcaatacatcgaggaaccagtg
gactctgtaaatgacatcatcaagttctgtgaaaatagtggcttgcctgttgcactagac
gagactatcgacaaccttacaggggatgtaatccctaagctacatcaattttcacatcca
ggaatagttgctcttgttataaaacccagtgttgttggtggctttgagactgcagcttat
atagcaaaatgggctcacatgcatgataagatggctgtcatcagtagcacctatgagagt
tctgtaggtttggcaacctatatacagtttgcacattatgttgacagacaaaatgacata
acatccagaataaagaacagaggttcttgtggaaatgtggcacatggacttggaacatac
caatggttaagggaagatgtttcagatcaaaagttaaaaatccatgcgccaccacttggt
gatggaatcagagcttcggcagaagatgcccatggctatctccagcatttagttataaac
gacaagaagatagaaagaacttatagtgaagaaaaattgaggtcatatttcatccaagtt
gatggggataatttttcttatcaagtcaagcttcaagagggtggtgattgcacacatgaa
aaggttattctctttcttcatggatttcttggtacgagtgaagactgggttccaatgatg
aaagctctctctcctagtgcacgggttatagctgtcgatcttcctggccatggcgagtcc
gaaattctacagcatgatgttgaaaactccaaccaaatctccttttcagttcaatcagtt
gcagatttgttactgaagttgataagaaatataactgatggagcggtggttgttgttggc
tactcaatgggtgcaaggattgcactacacatggcattaaatcaaaaccacaagataagt
ggagctgttataatttcgggtagtcctggattgagagacgaggcaagtaaaagacgtcgt
agtgctattgatagatcaagagcccacttcttgtcttcttgtggactggaaaattttctc
gagacgtggtactctgcgaaaatgtgggccagtttacgagaacatcctaaatttgattct
ctagtgaggacacgaatgaaacacaataatatcaaagctctatctaaggttctcgctgac
tcaagcatagggacgcaaaagtccctgtgggaagatttgaagcacttgaagagccctctc
ctcatcgtcgcaggtgaaaaggacccaaaattcaaagagatatcgcagcaaatgtgcagg
gagataagaaagcacaaggatcgcgaatccgatggtctatgtgagatgatcattattcca
gacagcggccacgccgtgcacgttgagaaccctcttcctttagttagagcaatcaggaag
ttcttggtaagggatataccagacgtgatatccaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268489
Entry
9268489           CDS       T01015                                 
Name
(RefSeq) isochorismate synthase 1, chloroplastic
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    9268489
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    9268489
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     9268489
SSDB
Motif
Pfam: Chorismate_bind RE_Bpu10I
Other DBs
NCBI-GeneID: 9268489
NCBI-ProteinID: XP_015611860
UniProt: A0A286T796
LinkDB
Position
9:11809612..11815324
AA seq 581 aa
MAPPPPPRTLSPSSSSPSLRSSGRRPLPSARLVGRWVQRPSCSLSMNGCGAAVAGAGAVA
VRETRALPAAGAAGDAVGQLREAVAALEAADPPASPSGIIRIEVPVRQRGDAVEWLHAQG
DLRARCFFSARAAAPLPECPALAIASAGNGNGNGAGGVGGEQRQRPVSVAGVGSAVFFRG
TEPFSLRDWRAIKRFLPRDCPLIRAYGAIRFDATSDHSVEWEEFGSFYFIVPQVEYNELE
ESSVLATTIAWDDSLSWTWQNAVKELQSTLQKISSSPIKVNNSTLQTTILNLNHVPTKAS
WDLAVTKALQMIKGKQRELVKVVLARCSRYITDTCIDPVELLACLKVEGQNAYQFCIQPP
DAPAFVGNSPEQLFHRKYLNISSEALAGTRARGKTRADDFQIGQDLLLSSKEDNEFTIVR
DSIKKKLEMICDDVVVHPSKALRKLPRVQHLSAQLAARMRNEDDEFDILNTLHPSPAVCG
LPTEEARQFIQDYEIFDRGMYAGPVGWFGGAESEFAVGIRSALLGKGHSTLVYAGAGIVE
GTNPSFEWDELDLKASQFAKLLQYQEQHICLQEAENMGTVI
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggcgccgccgccgccaccgcggacgctgtcgccgtcgtcttcgtcgccgtccctgcgc
tcctccggccgccgcccgctcccgtcggcgagactcgtgggaagatgggtgcagcggccg
tcgtgctcgctgtcgatgaatgggtgcggcgcggcggtggcgggggcgggggcggtggcg
gtgcgggagacgcgggcgttgccggcggcgggcgcggcgggggacgccgtggggcagctc
agggaggcggtggcggcgctggaggccgccgacccgccggcgtcgccctccggcatcatc
cgcatcgaggtgcccgtccggcagcgaggggacgccgtggagtggctgcacgcgcagggc
gacctgcgcgcgcgctgcttcttctccgcgcgtgccgccgctcccttgcccgagtgcccg
gccctcgccatcgcctccgccggcaacggcaacggcaacggagcaggcggcgtcggaggg
gagcagcggcagcggccggtgagcgtcgccggcgtcgggtccgccgtgttcttccgcggg
accgagccgttctccctccgcgactggcgcgccatcaagagatttcttccaagggattgc
ccactgattcgtgcttatggtgctatccgcttcgatgccacgagcgatcattcagttgaa
tgggaggaatttggatcattttacttcattgttcctcaagttgagtacaatgagcttgaa
gagagctcggttctcgcaacgacgattgcatgggatgattcactttcttggacatggcaa
aatgctgtgaaggagctccaatcaactttgcagaagatatcatccagtccaattaaagtg
aacaattccaccctgcaaacaaccatactaaatcttaatcatgtccccacaaaggcatcc
tgggatcttgccgttactaaagctctccagatgattaaagggaagcaaagagaattagta
aaggtcgtactggcaaggtgtagcagatatattactgatacttgcattgaccctgttgaa
ctgttggcatgtttaaaggttgagggccaaaatgcttatcagttctgtatacagccacct
gatgctcctgcatttgttggaaatagtccagagcaattatttcatcggaaatacttaaac
atttccagcgaggctttagctggtacacgagcaagggggaaaacaagggctgatgacttt
caaattggtcaagatttgctactaagtagcaaagaggataatgaatttactatagtacgg
gacagcataaagaagaagctggagatgatctgcgatgatgtggttgtccatcccagcaag
gcccttcggaaacttccaagagtacaacacctgtcagctcagttagctgcaagaatgagg
aatgaagacgatgagtttgacatcctaaatactcttcatccgagcccagccgtttgtggt
ctgcccactgaagaggcacgccaattcatacaagattatgaaatttttgaccgtggaatg
tatgctggacctgttggttggtttggaggagctgaaagtgagttcgctgttgggattaga
tcagcactactaggaaaaggtcatagcactttagtttatgctggtgccggaattgttgaa
ggtacaaatccatcctttgaatgggatgagcttgacctcaaagcatctcagtttgcaaag
ttactgcagtatcaagaacaacatatttgcttgcaagaggctgaaaatatgggaacagtg
atttga

DBGET integrated database retrieval system