KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329831
Entry
4329831           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L6-3
  KO
K02934  large subunit ribosomal protein L6e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329831
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4329831
SSDB
Motif
Pfam: Ribosomal_L6e Ribosomal_L6e_N
Other DBs
NCBI-GeneID: 4329831
NCBI-ProteinID: XP_015627578
UniProt: Q6YY64 Q69L78
LinkDB
Position
2:complement(22882161..22884163)
AA seq 219 aa
MAPTSKLSQGIKRASRSHTYHRRGLWAIKAKNGGTFPKAGKPAAAAEPKFYPADDVKPRA
PSTRKANPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRV
NQAYVIATSTKVDISGVKVDKFDDKYFARDKKAKAKKTEGELFETEKEATKNLPDFKKDD
QKAVDAELIKAIEVVPDLKSYLGARFSLRDGDKPHEMTF
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgccgacgtcgaagctgtcgcagggcatcaagcgcgcgtcgcggtcgcacacctac
caccgccgcgggctctgggccatcaaggccaagaacggcggcaccttccccaaggccggc
aagcccgccgccgccgccgagcccaagttctaccccgccgacgacgtcaagccccgcgcc
cccagcacccgcaaggccaaccctaccaagctcaggtcgaccatcacgccggggacggtg
ctgatcctgctcgccgggaggtacatggggaagcgcgtcgtgttcctcaagcagctcaag
tccggcctgctcctcatcaccggaccttttaagatcaatggagtgcccatccgccgtgtg
aaccaggcctacgtcattgccacatccacgaaggttgacatctctggtgttaaggtggat
aagtttgatgacaagtactttgcccgggacaagaaggcaaaggccaagaagaccgagggt
gaactttttgagacagagaaggaggcaaccaagaatctgcccgacttcaagaaggatgac
cagaaggctgtggatgctgagttgatcaaggctatcgaggttgtcccagacctgaaatcc
tatcttggtgcccggttctctctcagggacggcgacaagccccatgagatgacattctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336140
Entry
4336140           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L6-3
  KO
K02934  large subunit ribosomal protein L6e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336140
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4336140
SSDB
Motif
Pfam: Ribosomal_L6e Ribosomal_L6e_N DUF2849 Acetyltransf_11
Other DBs
NCBI-GeneID: 4336140
NCBI-ProteinID: XP_015636866
UniProt: Q7XR19 A0A5S6RB87
LinkDB
Position
4:complement(23660833..23663034)
AA seq 222 aa
MAPTSKLSQGIKKASRSHTYHRRGLWAIKAKHGGAFPKAEKPAAAAAAAAPKFYPADDVK
PRQPSTRKPNPTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPI
RRVNQPYVIATSTKVDISGVNVEKFDDKYFSRDKKQKAKKTEGELFETEKEATKNLPEFK
KEDQKVVDAELIKAIEAVPDLKTYLGARFSLRDGDKPHEMVF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcgccgacgtcgaagctgtcgcagggcatcaagaaggcgtcgcggtcgcacacgtac
caccgccgcgggctgtgggccatcaaggccaagcacggcggcgccttccccaaggccgag
aagcccgccgccgcagccgccgccgccgcgcccaagttctaccccgccgacgacgtcaag
ccccgccagcccagcacccgcaagcccaaccctaccaagctcaggtcgtccatcacgcct
gggacagtgctgatcctgctcgccgggaggttcatggggaagcgcgtcgtgttcctcaag
cagctcaaatccggcctgcttctcgtcaccggaccttttaagatcaatggagttccgatc
cgccgtgtgaaccagccctacgtcattgctacgtccacaaaggttgatatctctggtgtt
aatgtggagaagtttgatgacaagtacttctctagggacaagaagcagaaggcgaagaag
accgagggtgaactttttgagactgagaaggaggcaaccaagaacctgccggagttcaaa
aaggaggaccagaaagttgtggatgccgagttgatcaaagctattgaagctgtcccggat
ctgaaaacttaccttggtgcgcggttttctctcagggacggcgacaagccccacgagatg
gttttctag

DBGET integrated database retrieval system