KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329853
Entry
4329853           CDS       T01015                                 
Name
(RefSeq) beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00737  beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.144]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4329853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329853
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.144  beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     4329853
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4329853
SSDB
Motif
Pfam: Glyco_transf_17
Other DBs
NCBI-GeneID: 4329853
NCBI-ProteinID: XP_015622679
UniProt: Q0DZW5 Q6ZI62
LinkDB
Position
2:complement(23069732..23072541)
AA seq 391 aa
MEAAGYYNCKKNDGGICGGVCGGSEHGSKAILSMSRLKCALRGFDLRALLILLIGVPALI
FIIYVHGQKVTYFLRPIWEKPPKPFNVLPHYYHENVSMANLCKLHGWKVRETPRRVFDAV
LFSNELDILDIRWHELSPYVSEFVLLESNSTFTGLKKDLHFKENRQRFEFAESRLTYGMI
GGRFVKGENPFVEESYQRVALDQLIKIAGITDDDLLIMSDVDEIPSGHTINLLRWCDDTP
EVLHLQLRNYLYSFQFLLDDKSWRASIHRYRAGKTRYAHFRQTDDLLADSGWHCSFCFRH
INDFVFKMQAYSHVDRIRFKYFLNPKRIQHVICQGADLFDMLPEEYTFQEIIAKLGPIPS
TFSAVHLPAYLLEKMDQYRYLLPGNCMRESG
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaggcggcgggctactacaactgcaagaagaacgacggcggcatctgcgggggcgtc
tgcggcggcagcgagcatggttcaaaggcaattctgagcatgtcaaggttgaagtgtgcg
cttcgggggtttgatttgagggcacttctgatcctcttgattggtgtgccagctctaata
ttcattatatatgttcatggccagaaggtgacttactttcttcgaccgatctgggaaaaa
ccgccaaagcccttcaatgtgcttcctcactactatcatgaaaatgtctcgatggcaaac
ctatgcaagttgcatggatggaaagtcagggaaactccacgccgtgtttttgatgctgtg
cttttcagcaatgagcttgacattcttgatatccgttggcatgagcttagcccatatgtg
tcagaatttgtgctgctcgagtccaactcaaccttcactggcctgaaaaaggatctccac
ttcaaggaaaaccgtcaacgctttgaatttgctgaatcacggttgacctatggtatgata
ggtggaagatttgtgaagggggagaacccatttgtcgaggagtcatatcaaagggttgct
cttgaccagcttatcaaaattgctggaatcacagatgatgaccttttgatcatgtctgat
gttgatgagatccccagtggccatacaatcaacctcttgaggtggtgtgatgacactcct
gaagtgcttcatctccagctcaggaactatctttactcatttcagtttctccttgacgac
aagagttggagggcttcaatacacagataccgggctggaaagacgaggtatgcgcatttc
cggcaaacagacgaccttctggccgactcagggtggcactgcagcttttgcttccggcac
ataaatgattttgtcttcaaaatgcaagcttacagccatgttgaccggattagatttaag
tacttcttgaaccccaaaaggattcagcatgtgatatgccaaggagctgatctttttgac
atgcttcccgaagagtatacattccaagagatcattgccaagttggggccaatccctagc
acattttcagctgttcaccttcctgcttatctgttggagaaaatggaccagtaccgctat
cttcttccgggcaactgcatgcgagaaagtggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329854
Entry
4329854           CDS       T01015                                 
Name
(RefSeq) beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  KO
K00737  beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.144]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4329854
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4329854
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.144  beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     4329854
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4329854
SSDB
Motif
Pfam: Glyco_transf_17
Other DBs
NCBI-GeneID: 4329854
NCBI-ProteinID: XP_015627201
UniProt: B9F0U8
LinkDB
Position
2:complement(23083212..23086465)
AA seq 389 aa
MEAGGYYNCKKTDGICEDVCDSEHGSKAVFSMSRLKCALRGFDLRALLILLIGLPILIFV
IYLHGQKVTYFLRPIWEKPPKPFKVLPHYYNENVSMANLCKLHGWKVRETPRRVFDAVLF
SNELDILDIRWHELSPYVSEFVLLESNSTFTGLKKDLHFKENRQRFEFAESRLTYGMIGG
RFVKGENPFVEESYQRVALDQLIKIAGITDDDLLIMSDVDEIPSGHTINLLRWCDDIPEV
LHLQLRNYLYSFEFFLDDKSWRASIHRYRAGKTRYAHFRQTDDLLADSGWHCSFCFRYIS
DFVFKMQAYSHVDRIRFKYFLNPKRIQHVICRGADLFDMLPEEYTFQEIIAKLGPIPSTF
SAVHLPAYLLEKVDQYSYLLPGRCMRESG
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggaggccggcgggtactacaactgcaagaagacggacggcatctgcgaggacgtctgc
gacagcgagcatggttcaaaggcagtttttagtatgtcaaggctgaagtgcgcacttcgg
gggtttgatttaagagcacttttgatcctcttgattggtctgccaattctgatctttgtt
atataccttcatggccagaaagtcacttacttcctcagaccaatctgggaaaagccccca
aagcccttcaaagtacttcctcactactacaacgaaaatgtctcaatggccaacttatgc
aagttacatggatggaaagtcagggaaacgccgcggcgtgtttttgatgctgtgcttttc
agcaacgagcttgatattcttgatatccgttggcatgagcttagcccttatgtgtcagag
tttgtgttgcttgagtccaactcaaccttcactggccttaaaaaggatctccacttcaag
gaaaaccgtcaacgttttgaatttgctgaatcacggttgacctatggtatgataggtggt
cggtttgtgaagggggagaacccatttgtcgaggagtcatatcagagggttgctcttgac
cagcttattaaaattgccgggatcacagatgatgacctgttgatcatgtctgatgttgat
gagattccaagtgggcatacgatcaacctcttgagatggtgtgatgacatacctgaagta
ctccatctccagctcaggaactatctgtactcatttgaatttttccttgatgacaaaagt
tggagggcttcaattcacagataccgggctggaaagacgaggtatgcacatttccggcaa
acagatgaccttctggctgattcaggatggcactgcagcttttgttttcgctacattagt
gattttgtcttcaaaatgcaagcttatagccatgttgatcggattagatttaagtacttc
ctgaaccccaaaagaattcagcatgtgatatgccgaggagccgatcttttcgacatgctt
cctgaagaatacacattccaagaaatcattgccaagctgggtccaatcccaagcacattt
tctgccgttcatcttcctgcttatttgctagagaaagtagatcagtacagttatcttctt
ccagggcgatgcatgagagagagtggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336162
Entry
4336162           CDS       T01015                                 
Name
(RefSeq) beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  KO
K00737  beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.144]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4336162
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4336162
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.144  beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     4336162
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4336162
SSDB
Motif
Pfam: Glyco_transf_17
Other DBs
NCBI-GeneID: 4336162
NCBI-ProteinID: XP_015637122
UniProt: Q7XK38 A0A0P0WBK6
LinkDB
Position
4:complement(23893468..23896494)
AA seq 388 aa
MPETGPYGHKKTDGICDGVCGEPASKAVLTMSRLRCALRGFDFRALLALLIGVPILILMI
YAHGQKVTYFLRPIWESPPKPFKTIPHYYHENVTMAKLCKLHGWKVRETPRRVFDAVLFS
NELDILEIRWNELSPYVSEFVLLESNSTFTGLKKPLHFKENRHRFGFAESRLTYGMIGGR
FVKGENPFVEESYQRVALDQLIKIAKIEDDDLLIMSDVDEIPSGHTIDLLRWCDDIPEIL
HLQLRNYLYSFEFFLDDKSWRASIHRYRSGKTRYAHFRQTDELLADSGWHCSFCFRYISD
FAFKMQAYSHVDRIRFKYFLNPERIQDVICRGADLFDMLPEEYTFQEIIAKLGPIPSTFS
AVHLPSYLLQNVDRYRYLLPGYCRRESG
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgccggagaccgggccctacggccacaagaagaccgacggcatctgcgacggcgtgtgc
ggcgagcctgcgtcaaaggcagttctgaccatgtcgaggctgagatgtgcacttcgggga
tttgatttcagagcactattggccctattgataggagtgccaattctaattttaatgata
tatgctcatggtcagaaggtcacatacttcctcaggccaatatgggagtctcctcccaag
cccttcaaaactatccctcattactaccatgagaatgtcaccatggcgaaactctgcaag
ttgcatgggtggaaagtccgggagaccccacgacgtgtcttcgatgctgtactattcagc
aatgagctcgatattcttgaaatacgttggaatgaactaagcccctatgtctcagagttt
gtgctgcttgagtcgaactcaaccttcactggattgaaaaagcccctgcacttcaaggaa
aatcgtcatcgatttggatttgctgaatcacggctgacatatggtatgattgggggaagg
ttcgtgaagggagaaaacccatttgttgaggagtcatatcagagggttgccctggaccag
cttattaagattgcaaaaatagaagatgatgacctgttgatcatgtcagatgttgatgaa
atcccaagtggccacacaattgatctcctgagatggtgcgacgacattcctgagatcctt
catcttcagcttaggaattacctctactcatttgaatttttcctggatgacaaaagttgg
agggcatcgatacacaggtacaggtctgggaagacaagatatgcacacttccggcagaca
gatgagcttcttgctgattcagggtggcactgcagtttttgctttcgctacattagtgat
tttgccttcaaaatgcaagcttacagccatgtcgatcggattagatttaagtacttcctg
aaccctgaaaggattcaagatgttatatgcagaggggcggatctttttgacatgcttcct
gaagagtacacgttccaagagatcattgccaagttggggccgattccaagcacattttct
gctgttcatcttcctagctatctgctacagaatgttgatcggtacagataccttctccca
gggtactgcaggagagaaagtgggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352772
Entry
4352772           CDS       T01015                                 
Name
(RefSeq) beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  KO
K00737  beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.144]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4352772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4352772
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.144  beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     4352772
Glycosyltransferases [BR:osa01003]
 Glycan extension
  N-Glycan
   4352772
SSDB
Motif
Pfam: Glyco_transf_17 Glycos_transf_2
Other DBs
NCBI-GeneID: 4352772
NCBI-ProteinID: XP_015618395
UniProt: Q2QMA5 A0A8J8XNV4
LinkDB
Position
12:25881787..25887379
AA seq 364 aa
MARTSPFPPLTRRKIASLKLLIPCVLVLSVAVIVVTQYFHNISYLLRPLWDTPPKPFIRI
PHYYAPNISMPQLCQLHGWGILPTPRRVFDAVLFSNELDILEIRYGELLPYVDRFVILEA
NATFTGIPKSLSFLENINRFAFAGSKIVYDMLPVMEMDPGSHRQPFHVEAGHRRALNMLL
RRSGIAVGDVLIMADADEIPSPETVQLLKWCDGIPQVMHLELKNYMYSFEFPIDYNSWRA
TAHVFTEHTLYRHSRQSNLLLADAGWHCSFCFKDIKEFAFKMKAYSHADRVKQDSFLNPD
RIQRVICNGEDLFDMLPEEYTFKDLFKKMGPIPKSGSAVHLPSYLIKNADKFRFLLPGGC
LRPG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggctagaacctctccttttccacctctaactagacggaaaatcgcttccctcaagttg
ctgataccatgtgttctagttctttcagtggctgttattgttgttacgcagtatttccat
aatatctcttaccttctgcggccactgtgggacacaccacctaagccatttatccgcatc
ccacactactatgcccccaacatctccatgccgcagctctgtcagctccatggttggggt
atcctccccacccctcgccgtgtctttgacgccgtcctcttcagtaatgaacttgatatt
ctagaaattcgctacggtgagctccttccgtatgttgacaggtttgtcatccttgaagct
aatgccacattcactggcatcccgaagtcactctctttcttggaaaatatcaatcgcttt
gcattcgctggctccaagattgtgtatgacatgcttcctgtcatggaaatggatcccggt
tctcaccgtcagcccttccatgttgaggccggccaccgtcgtgcgcttaatatgctgctg
cgaagatcaggcattgctgtgggggatgtattgatcatggctgatgctgatgagatccct
agccctgagacggtgcagttgctcaagtggtgtgatggaataccgcaagtcatgcatctc
gagctgaagaactatatgtactcctttgaatttcctatagactacaacagctggagggcc
acagcacatgtgttcactgagcatacattgtaccgccactcccgtcagagcaaccttctg
ctggctgatgcaggctggcattgtagcttctgcttcaaggacatcaaggagtttgctttc
aagatgaaggcatatagccacgcagaccgggtgaagcaggacagcttcctaaatccagac
agaatccagagggtcatatgtaatggggaggacctgtttgacatgctgcctgaagagtac
acattcaaggatctcttcaagaagatgggacccataccaaagtcaggatctgctgttcat
ctgccttcctatttgatcaagaacgcagacaagttcagattcttgctccctggtggatgc
ttgagaccaggctaa

DBGET integrated database retrieval system