KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329918
Entry
4329918           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4329918
  KO
K12501  homogentisate solanesyltransferase [EC:2.5.1.117]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00933  Plastoquinone biosynthesis, homogentisate + solanesyl-PP => plastoquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4329918
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4329918
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.117  homogentisate solanesyltransferase
     4329918
Prenyltransferases [BR:osa01006]
 Compound prenylation
  HGA prenyltransferase
   4329918
SSDB
Motif
Pfam: zf-TRAF zf-TRAF_2 MetOD2 P66_CC CLZ Med9 DUF16
Other DBs
NCBI-GeneID: 4329918
NCBI-ProteinID: XP_015626139
UniProt: A0A0P0VLF0
LinkDB
Position
2:complement(23726253..23729123)
AA seq 355 aa
MENLECTVGKDGLNFQCNLCDSDVVHSMAEILLRGLATASVDSTTGDIFKSPSSVAVGMK
SELAEYLIQGSMTLVREAVDGGEDHSEQLIKASTMPTEFLSDLIDGFVASKRNLLSHVSG
FLSSETRLNKIKDFIQKLEMENFWAPDVREATAGTILKSIDMKCIIHCPERFDTQDKLAE
HRNLCRFRIVNCKNDGCLASFSANHIEKHDSVCPFKVLPCEQLCEQHVMRCEMDRHCASV
CPMKLINCPFYQVGCESAFPQCVLDKHCSERLQIHLMYILELTTRHDAFVNDMNQRLHLL
EKAQSLNELSGALDNRTLTLTAKEQEAKIKKLEQDLKVQETKLKKLESEFKSGKV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagaaccttgaatgcacagttgggaaagatggcttaaattttcagtgcaacctgtgt
gattcagatgtagtgcattccatggcagaaatcctgcttcgtggattggcaactgcctca
gttgacagcactactggtgatatcttcaagagcccatcttctgtagctgttggaatgaag
agcgagctagcagaatatttgattcaggggtccatgacgcttgttcgtgaggctgtcgac
ggaggcgaggatcactcagaacaattaataaaagcatccaccatgccgacggagttcctc
tcagacttgatcgatggttttgtagcatcaaaacggaacttgttgagccatgtgtctggg
tttttgtctagcgaaacccgcttgaacaaaattaaagacttcatacagaagctggagatg
gagaacttctgggcaccagatgttagagaggctactgcagggactattcttaagagtata
gacatgaaatgcattatccattgccctgagagatttgacacacaagataagctggctgaa
cacaggaatctgtgtagatttaggatagtaaactgcaaaaatgatggatgtttagcttcc
ttttctgctaatcacattgagaagcatgactctgtctgcccattcaaagtcctaccatgt
gagcagttgtgcgagcagcatgttatgcggtgtgagatggacaggcattgtgcatcagtt
tgccctatgaagcttattaactgccctttttaccaggttggctgtgaatcagcctttccg
cagtgtgttcttgataagcattgttcagagcgccttcaaatccatctgatgtatattctt
gaactaactacaagacatgatgcttttgttaatgatatgaatcaacgattacacctcctt
gagaaggcccagtcactgaatgaactctctggggctttagataacagaaccctcactcta
acagcaaaggagcaagaagcaaagatcaagaaactcgaacaggatctcaaagtgcaagag
acaaagctgaagaaacttgaaagcgagtttaagtcagggaaagtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343702
Entry
4343702           CDS       T01015                                 
Name
(RefSeq) probable homogentisate phytyltransferase 2, chloroplastic
  KO
K12501  homogentisate solanesyltransferase [EC:2.5.1.117]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00933  Plastoquinone biosynthesis, homogentisate + solanesyl-PP => plastoquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4343702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4343702
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.117  homogentisate solanesyltransferase
     4343702
Prenyltransferases [BR:osa01006]
 Compound prenylation
  HGA prenyltransferase
   4343702
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 4343702
NCBI-ProteinID: XP_015646905
UniProt: Q0D576
LinkDB
Position
7:23302342..23309719
AA seq 379 aa
MASLASPPLPCRAAATASRSGRPAPRLLGPPPPPASPLLSSASARFPRAPCNAARWSRRD
AVRVCSQAGAAGPAPLSKTLSDLKDSCWRFLRPHTIRGTALGSIALVARALIENPQLINW
WLVFKAFYGLVALICGNGYIVGINQIYDIRIDKVNKPYLPIAAGDLSVQTAWLLVVLFAA
AGFSIVVTNFGPFITSLYCLGLFLGTIYSVPPFRLKRYPVAAFLIIATVRGFLLNFGVYY
ATRAALGLTFQWSSPVAFITCFVTLFALVIAITKDLPDVEGDRKYQISTLATKLGVRNIA
FLGSGLLIANYVAAIAVAFLMPQAFRRTVMVPVHAALAVGIIFQTWVLEQAKYTKDAISQ
YYRFIWNLFYAEYIFFPLI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcttccctcgcctcccctcctctcccctgccgcgccgccgccaccgccagccgcagc
gggcgtcctgctccgcgcctcctcggccctccgccgccgcccgcttcccctctcctctcc
tccgcttcggcgcgcttcccgcgtgccccctgcaacgccgcacgctggagccggcgcgac
gccgtgcgggtttgctctcaagctggtgcagctggaccagccccattatcgaagacattg
tcagacctcaaggattcctgctggagatttttacggccacatacaattcgaggaactgcc
ttgggatccatagcattagttgctagagctttgatagagaacccccaactgataaattgg
tggttggtattcaaagcgttctatgggctcgtggcgttaatctgtggcaatggttacatc
gttgggatcaatcagatctatgacattagaatcgataaggtaaacaagccatatttacca
attgctgccggtgatctctcagttcagacagcatggttattggtggtattatttgcagct
gcgggattttcaattgttgtgacaaactttggacctttcattacctctctatattgcctt
ggtctatttcttggcaccatatactctgttcctccattcagacttaagagatatcctgtt
gctgcttttcttatcattgcaacggtccgtggttttcttctcaactttggtgtgtactat
gctactagagcagcactgggtcttacattccaatggagctcgcctgttgctttcattaca
tgcttcgtgactttatttgctttggtcattgctataaccaaagatctcccagatgttgaa
ggggatcggaagtatcaaatatcaactttggcgacaaagctcggtgtcagaaacattgca
tttcttggctctggtttattgatagcaaattatgttgctgctattgctgtagcttttctc
atgcctcaggctttcaggcgcactgtaatggtgcctgtgcatgctgcccttgccgttggt
ataattttccagacatgggttctggagcaagcaaaatatactaaggatgctatttcacag
tactaccggttcatttggaatctcttctatgctgaatacatcttcttcccgttgatatag

DBGET integrated database retrieval system