KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329961
Entry
4329961           CDS       T01015                                 
Name
(RefSeq) phosphatidyl-N-methylethanolamine N-methyltransferase
  KO
K00550  phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.71]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4329961
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     4329961
SSDB
Motif
Pfam: PEMT DUF639 ICMT
Other DBs
NCBI-GeneID: 4329961
NCBI-ProteinID: XP_015625309
UniProt: A0A8J8YG10 A3A901
LinkDB
Position
2:24095785..24097712
AA seq 168 aa
MEMAAAAVGVLLPFPFYWALWNHPQRWVDLCGGGGGGVDPCRRMAQVSHVLKALQLLALA
SVASFSWPPPLYSVALLAVGQYLNFKVYQLLGEPGTYYGVRFGKKIPWVTEFPFGYIKDP
QYVGSMLSLVALLCWVPFQYVLLWCLGYVFMMWVESKEDPATRAKLLS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggaaatggcggcggcggccgtcggcgtgctgctgccgttcccgttctactgggcgctc
tggaaccacccgcagcggtgggtcgacctgtgcggcggaggcggcggcggcgtggacccg
tgccgccggatggcgcaggtgtcccacgtcctcaaggcgctgcagctcctcgccctcgcc
tccgtcgcctccttctcctggccgccgccgctctactccgtcgccctcctcgccgtcggc
cagtacctcaatttcaaggtgtaccagctgctcggtgagccaggcacctactacggtgtt
cgatttggaaagaaaatcccatgggtgacagaatttccatttggttatatcaaagaccct
caatatgttggcagcatgctcagccttgtggcactgctttgttgggttccattccaatat
gttcttctctggtgcctcggctacgttttcatgatgtgggtggaaagcaaggaagatcct
gccactcgtgccaagctgctctcctga

DBGET integrated database retrieval system