KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329963
Entry
4329963           CDS       T01015                                 
Name
(RefSeq) nuclear cap-binding protein subunit 2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329963
  09122 Translation
   03013 Nucleocytoplasmic transport
    4329963
   03015 mRNA surveillance pathway
    4329963
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329963
   03041 Spliceosome [BR:osa03041]
    4329963
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     4329963
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    4329963
SSDB
Motif
Pfam: RRM_1 DUF5721
Other DBs
NCBI-GeneID: 4329963
NCBI-ProteinID: XP_015625308
UniProt: Q84L14
LinkDB
Position
2:complement(24100127..24103567)
AA seq 243 aa
MASLFKDPTKLSAYRDRRFTGTQEEYEAALQASVTVYVGNMSFYTTEEQAYELFSRAGEI
RKIIMGLDKNSKTPCGFCFILYYSREDAEDAVKYISGTMLDDRPIRVDFDWGFEEGRQWG
RGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYGGAFQPNAPPQYDRGDRKRG
YGDSYRNDRDYQRKRYRNDERSSQRAPDSEFKRDAIDSEKNPRFREKGDSDEEDDDYDKR
RRR
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcgtccctcttcaaggacccgaccaagctgtccgcgtaccgggacaggcggttcacc
gggacgcaggaggagtacgaggcggcgctgcaggcgtcggtgacggtgtacgtcgggaac
atgtccttctacaccacggaggagcaggcctatgagctcttctcccgcgccggcgagatc
aggaagatcatcatgggactcgacaagaactccaagaccccctgcggcttctgcttcata
ctgtactactccagggaggatgctgaagatgcggtcaaatatattagtggaacaatgctt
gatgatcgcccaattcgtgttgattttgattggggctttgaagaaggcagacaatggggt
cgtggacggagtggtggacaagtaagggatgagtaccgcacggactacgatcctggaaga
ggtggctatggtaagatggttcagaaagagctagaagcacaacgtgagttagttgactat
ggaggtgcttttcaacctaatgcaccacctcaatatgacagaggtgacaggaagagaggg
tatggagattcttaccggaacgacagagattaccaacggaaacgttaccggaacgatgag
cgatcgtcgcaaagagcacctgactctgagttcaagagagatgcgattgattcggagaag
aatcctaggtttcgtgagaaaggtgattctgatgaagaagacgatgattatgataagaga
cgccggcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332822
Entry
4332822           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: nuclear cap-binding protein subunit 1-like
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332822
  09122 Translation
   03013 Nucleocytoplasmic transport
    4332822
   03015 mRNA surveillance pathway
    4332822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332822
   03041 Spliceosome [BR:osa03041]
    4332822
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     4332822
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    4332822
SSDB
Motif
Pfam: MIF4G_like_2 MIF4G_like MIF4G DUF5798 RPW8 DUF5742
Other DBs
NCBI-GeneID: 4332822
NCBI-ProteinID: XP_015630619
LinkDB
Position
3:12976118..12988246
AA seq 910 aa
MSAGWRTLLLRIGDRCPEYGGSADHKEHIETCYGVLCREYEHSKDAMFEFLLQCADQLPH
KIPFFGVLIGLINLENEDFSKGIVDTTHANLQDALHNENRDRIRILLRFLCGLMCSKVVL
PNSIIETFEALLSSAATILDEETGNPSWQPRADFYVYCILASLPWGGSELFEQVPDEFER
VLVGIQSYISIRRHFDDIAFSVFETDEGNSPNKKDFIEDLWERIQVLSRNGWKVKSVPKP
HLSFEAQLVAGVSHRFSPISCPPPTISQSSSEIVKGQEKHEADLKYPQRLRRLHIFPTNK
AENMQPVDRFVVEECILDVLLFFNGCRKECAFYLVSLPVPFRYEYLMAETIFSQLLLLPN
PPFRPIYYTLVIIDLCKALPGAFPSVVVGAVHALFDRISNMDMECRTRLILWFSHHLSNF
QFIWPWQEWAYVKDLPKWAPQRVFVQEVLEREIRLSYFDKIKQSIEDAVELEELLPPKAG
PNFRYHSDEGKESTDGHRLSKELVAMVRGRKTQGDIISWVDEKIIPVNGAKFALDVVSQT
LLDIGSKSFTHLITVLERYGQIISKLCPNEEMQLLLMDEVSAYWKNSTQMIAIAIDRMMG
YRLLSNLAIVKWVFSPANVDQFHVSDRPWEILRNAVSKTYNRIFDLRKEIQTLRKGLQAA
KEASEKAARELEEAKSIIEIVDGQPVPSENPGRLRRLQARADKAKEGEVTTEESLEAKEA
LLARGLEESKELLRLLFKSFVEVLTERLPPISADGDVPNLRAGDPNVNSSARDPEATTME
IDNENGGDNDSQLNGQNKKISHNVGELEQWCLCTLGYLKSFSRQYATEIWSHIAMLDQEI
FVGNIHPLIRKAASPVCADLPVKGLTFDFDPSSELEFTCIIRDKFFIMXSLTGHAQKYSD
VYSGTPSILL
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgagcgcgggctggaggacgctgctgctgcggatcggcgacaggtgcccggagtacggg
ggctccgccgaccacaaggagcacatcgaaacttgttatggtgtgctttgtcgagaatac
gaacactccaaagatgcaatgtttgagtttctcctccaatgtgcagatcaattgcctcac
aagattcctttctttggagtattgataggtttgataaacttggaaaatgaagatttttcc
aagggtattgtcgatacaacacatgccaatttacaggatgccttgcataatgaaaatcgt
gacagaatcaggatattgctgcgatttctctgtggcctgatgtgcagcaaagttgtcctg
ccaaattctattattgaaacatttgaggcactattatcatctgctgcaacaatattagat
gaggaaaccggaaatccttcgtggcaaccacgtgctgatttctatgtttattgtatcttg
gcttcccttccatggggtggctcagaattgtttgagcaagttccagatgaatttgagaga
gttctggttggtatacagtcttatataagcattagaaggcattttgatgatattgctttc
tcagtctttgaaacagatgaaggcaactctcccaacaaaaaggatttcatcgaagattta
tgggagcgtattcaagttctttctcgcaatgggtggaaggttaagagtgttccaaaacct
cacctgtcgtttgaagctcagctggtagctggagtttctcaccgtttctccccaattagt
tgccccccacctactatctcgcaatcatcttctgaaatagtaaaaggtcaagaaaagcat
gaagctgatctgaagtatcctcaaaggcttcgtaggcttcacatatttccaacaaataaa
gctgagaacatgcaacctgtagatcgttttgttgttgaagaatgcatattggatgtgcta
cttttcttcaatggatgtcgcaaagaatgtgcattttatctggtcagcttacctgtgcct
ttccgttatgaatacctgatggctgagaccatattttcacagctactgttattgccgaat
ccccctttcaggccaatttactataccttggttattatcgacctttgcaaggcattgcca
ggtgcatttccttcagttgtggtaggagcagtacatgctctttttgacagaattagcaac
atggatatggagtgccgcacccgacttatcctatggttttcacatcacttgtcaaatttt
cagttcatttggccttggcaggagtgggcttacgtcaaggaccttccaaaatgggctcca
cagcgtgtttttgtccaagaagtattagaaagggaaattcgcttgtcctactttgacaaa
attaagcagagcatagaggatgctgttgaattggaagaactgttacccccaaaagctggg
cctaacttcagatatcatagtgatgaaggcaaagaaagcactgatggccacagactctcc
aaggaacttgttgccatggttagaggaaggaagacacaaggtgatattatttcatgggta
gacgaaaaaataattcctgtaaatggtgccaaatttgcacttgatgtagttagccagaca
cttctggacattggctcaaaaagtttcacccatcttatcactgttttggagagatatggt
caaataatatcaaagctgtgcccgaatgaagaaatgcagttattgttgatggatgaagtc
agtgcttattggaagaacagtacccagatgattgccatagctattgataggatgatgggt
tatcgcctactttccaatctggctatagtcaaatgggttttttctcctgctaatgttgat
caatttcatgtttcagatcgtccatgggagattcttagaaatgctgttagtaaaacatac
aatcggatttttgacctccggaaagaaattcagacactcaggaaaggtcttcaagctgct
aaagaggccagtgaaaaggccgccagagagttggaggaggctaaatctattattgagatt
gtagatggccaacctgtgccatctgaaaatccaggaaggctaagacgacttcaagcgcgt
gctgacaaagcgaaagaaggagaagtaaccactgaagaatctttagaagcaaaggaggcc
ctccttgctcgagggcttgaagaaagcaaggaattgcttaggttactattcaagagcttt
gttgaagtgctaactgaacgtttgccacctatttctgctgatggagatgttcctaattta
cgtgctggagacccgaatgtaaattcttcagcccgtgaccctgaagcaacaaccatggaa
atagacaatgaaaatggaggagataacgatagtcagctgaatggtcaaaacaagaaaatc
agtcacaatgttggagagcttgagcaatggtgtctctgcacattgggctatctcaagtcg
ttttctcgtcaatatgctactgagatctggtcccatattgccatgttggatcaggagatt
ttcgttgggaatattcaccctcttatccggaaagctgcttctccggtttgtgcagaccta
ccagtgaagggtctcacctttgattttgacccttccagtgagttggagtttacctgtatt
atacgcgacaaatttttcatcatgncttcactaactggacatgcccaaaagtactctgat
gtgtactcaggaactccatcgattctcctgtaa

DBGET integrated database retrieval system