KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330016
Entry
4330016           CDS       T01015                                 
Name
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4330016
   00640 Propanoate metabolism
    4330016
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330016
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     4330016
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     4330016
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4330016
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Other DBs
NCBI-GeneID: 4330016
NCBI-ProteinID: XP_015625812
UniProt: Q6K9N6 S4TZU3
LinkDB
Position
2:24741754..24747768
AA seq 422 aa
MVRGSLGKLASRALSVAGKWQHQQLRRLNIHEYQGAELMGKYGINVPRGAAAGSVEEVKN
TLKNVFPSEKEIVVKSQILAGGRGLGTFKSGLQGGVHIVKAEEAESLAAKMLGQILVTKQ
TGPQGKIVSKVYLCEKLSLVNEMYFAITLDRNTAGPLIIACSKGGTSIEDLAEKYPDMII
KVPIDVFKGITDDDAAKVVDGLAPKTADRQSSIEQIKKLYELFCKSDCTLLEINPLAETA
DNKLVAADAKLNFDDNAAFRQKEIFAMRDTTQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGSASEGQVVEAFKILTSDDRVKAILVNIFGGIMKC
DVIASGIVNAAKQVDLKVPVVVRLEGTNVDQGKRILKESGMTLITAEDLDDAAEKAVKAS
VK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggttcgcggatcgctcgggaagctggcctcgcgcgccctctccgtcgccgggaaatgg
cagcaccagcagctccgccgcctcaacatccacgagtaccagggcgcggagctgatgggg
aagtacgggatcaacgtgcccaggggcgcggcggcgggatcggtggaggaggtcaaaaac
accttgaagaacgtcttccctagtgagaaagagatagttgttaagagtcaaatcctggct
ggtggccgtggattgggaacattcaaaagtggactgcagggtggtgttcatattgttaag
gcagaggaagctgaaagcctcgcagcaaaaatgcttggccagattctggtaacaaaacaa
actggtccacaggggaagattgtgagcaaggtctacttatgtgagaaactgtcacttgtt
aatgagatgtacttcgccatcacccttgacaggaatactgctggtccgctcattatagcg
tgcagcaagggaggaaccagtattgaagatcttgcagagaagtaccctgatatgatcatc
aaggttcctattgatgtattcaagggaatcacagatgatgatgcagctaaagttgttgat
ggtctggcaccaaagacagctgacagacagtcttccatagaacagattaagaagctctat
gaactgttctgcaagtctgattgcacactgctcgagattaatcctcttgctgagacagct
gacaacaagctggtcgctgctgatgcaaagttgaactttgatgacaatgctgcctttagg
cagaaagagatatttgccatgcgtgacacaacacaggaagatcccagagaggtggctgct
gccaaagctgacttgaactacattgggcttgatggagaaattggctgcatggtgaacggt
gcaggattggcaatggctacaatggacatcattaagttgcatgggggtacgcctgccaat
tttcttgatgttggtggaagtgcatcagagggacaggttgtggaagcatttaagattttg
acttccgatgatagagtgaaggctattctagtgaacatttttggtggtatcatgaaatgt
gatgtgatagcaagtggaatagtgaatgcagcaaaacaggttgacctgaaggtgcctgtt
gttgttcggttggaaggcaccaatgttgaccaagggaagaggattctaaaggaaagtgga
atgaccttaatcactgcagaggatcttgatgatgcggctgagaaagctgtaaaagcatct
gtcaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343710
Entry
4343710           CDS       T01015                                 
Name
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4343710
   00640 Propanoate metabolism
    4343710
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     4343710
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     4343710
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Other DBs
NCBI-GeneID: 4343710
NCBI-ProteinID: XP_015647737
UniProt: Q6ZL94
LinkDB
Position
7:23361139..23365939
AA seq 331 aa
MAASARRASQLLGSAASRLLHARGFAAAAAAAPSPAVFVDKSTRVICQGITGKNGTFHTE
QAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAM
EAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKP
GRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIV
LIGEIGGTAEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK
ALREAGVTVVESPAKIGSTMFEIFKQRGMLE
NT seq 996 nt   +upstreamnt  +downstreamnt
atggccgcctccgcccgccgcgcgtcccagctgctgggatccgcggcctcccgcctcctc
cacgcgcggggcttcgcggcggcggccgcggccgcgccgtcgccggcggtgttcgtggac
aagagcacccgcgtgatctgccagggcatcaccgggaagaacggcaccttccacaccgag
caggccatcgagtacggcaccaccatggtaggtggggttacccctaagaaaggtggaacc
gagcacctaggccttccggtgttcaactctgtggcagaagctaaggctgagacaaaggcg
aatgcatctgttatatatgttccaccaccatttgctgctgctgcaataatggaagcgatg
gaggccgaacttgaccttgttgtctgcattaccgaagggatacctcagcatgacatggtg
aaagtgaaggctgctctgaacaagcaatcaaaaactcggttgattggaccaaattgccct
ggtatcattaagccgggtgaatgtaaaattggaatcatgccaggttacatccacaagcca
ggtcgtgttgggatagtatctcgctctggtaccttgacatatgaagcggtgtttcaaaca
acagccgtaggcttggggcagtcaacgtgtgttggcattggtggtgatcccttcaatggc
acgaattttgttgattgccttgaaaagtttgttgatgatcctcagacagaaggtattgtt
ctcatcggagaaattggaggtactgctgaggaggatgctgcagccttcattcaggagagc
aaaacacaaaagcctgttgttgcattcatagctggactcactgctccacctgggcgtcgc
atgggtcatgctggagcaattgtgtcagggggcaagggtacggcacaagacaaaatcaag
gctctcagagaggctggggttactgttgttgagtcaccagcgaagattggttcaactatg
ttcgaaattttcaagcaacgcggaatgttagaatag

DBGET integrated database retrieval system