KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330020
Entry
4330020           CDS       T01015                                 
Name
(RefSeq) probable 60S ribosomal protein L14
  KO
K02875  large subunit ribosomal protein L14e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330020
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4330020
  Archaea
    4330020
SSDB
Motif
Pfam: Ribosomal_L14e TBPIP
Other DBs
NCBI-GeneID: 4330020
NCBI-ProteinID: XP_015622875
UniProt: Q6K9M9 Q6K1Q6
LinkDB
Position
2:complement(24777871..24779713)
AA seq 134 aa
MPFKRFVEIGRVALVNYGKDYGRLVVIVDVVDQNRALVDAPDMVRCQINFKRLSLTDIKI
DIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGA
IRQELAKLKKTAAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgccgttcaagaggttcgtggagatcgggcgggtggccctggtgaactacggcaaggac
tacggccgcctcgtcgtcatcgttgatgtcgtcgaccagaaccgggcacttgtggatgct
cctgacatggtcaggtgccagatcaacttcaagaggctttccctgactgacatcaagatt
gacatcaaacgtgtcccgaagaagacaactttgattaaggctatggaggaggctgatgtt
aagaacaagtgggagaatagctcatggggcaagaagctaattgtccagaagaggagagcg
tcactcaatgactttgacaggttcaaggttatgttggccaagatcaagaggggaggtgct
atcaggcaagagcttgcgaagctcaagaagactgccgcggcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336397
Entry
4336397           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L14-1
  KO
K02875  large subunit ribosomal protein L14e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336397
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4336397
  Archaea
    4336397
SSDB
Motif
Pfam: Ribosomal_L14e Coatomer_b_Cpla TBPIP
Other DBs
NCBI-GeneID: 4336397
NCBI-ProteinID: XP_015636847
UniProt: A0A0P0WCT0 Q7X752
LinkDB
Position
4:complement(25751365..25753393)
AA seq 134 aa
MPFKRFVEIGRVALVNYGKDYGRLVVIVDVVDQNRALVDAPDMVRCQINFKRLSLTDIKI
DIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGA
IRQELAKLKKEAAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgccgttcaagaggttcgtggagatcgggcgggtggccctggtgaactacggcaaggac
tacggccgcctcgtcgtcattgtcgatgtcgtcgaccagaacagggcacttgtggatgcc
cctgatatggtccgctgccagataaacttcaagcggctttctctgactgacattaagatt
gacatcaagcgtgtccctaagaagaccaccttgattaaggcaatggaggaagctgatgtg
aagaacaagtgggagaacagctcatggggtaagaaactgattgtccagaagaggagagca
tccctcaacgactttgacaggttcaaggttatgttggcgaagatcaagcgtggcggcgct
atcagacaggagcttgctaagcttaagaaggaggctgctgcgtag

DBGET integrated database retrieval system