KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330025
Entry
4330025           CDS       T01015                                 
Name
(RefSeq) lysine--tRNA ligase, chloroplastic/mitochondrial
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4330025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330025
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4330025
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     4330025
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4330025
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4330025
 Prokaryotic type
   Other AARSs
    4330025
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d Nucleoporin_N
Other DBs
NCBI-GeneID: 4330025
NCBI-ProteinID: XP_015627222
UniProt: Q6K1T2 A0A0N7KFQ1
LinkDB
Position
2:complement(24847999..24860114)
AA seq 586 aa
MEALRAWRASSNLLGFAASRAAKAAPAARPLRPHVRCCSPAAASTTKPPPPPPQDRRRRS
ASSSSSSTSDRESIRAIRLKKVEELRGKGYEPYAYKWDRTHTTKELQDGYTHLENGEVCA
DVAVSIAGRIVARRAFGKLVFMTVRDDSGTIQLYCEKDSLTEEQFEQLKTIIDIGDIIGA
NGSIKKTEKGELSVYVKNFEILTKSLLPLPDKYHGLTDVDKRYRQRYVDMIANPEVADVF
RTRAKAVSEIRKTMESFGFIEVETPVLQGAAGGAEARPFITHHNSLQRDLYLRIATELHL
KRMLVGGLEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYESMMNLAEEIVTRCAMA
THGKLRVDYQGTEISLERPWRRETMHSLVKEATGIDFNSFGEDLESAKNAARGIKTESNE
NISLQACSSVGHVLNEVFETVVESSLVQPTFVLDYPVEISPLAKPHRRYAGLTERFELFI
CGREIGNAFSELTDPIDQRGRFENQIKQHNAKRAAMTKEVKSTEGKHEEDDFSYEVTLDE
DFLTSLEYGMPPASGMGLGIDRLVMLLTNSASIRDVIAFPVLKIQQ
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggaggcgctgcgggcgtggagggcttcctccaatctcctcggcttcgcggcctctcgc
gccgccaaggccgccccagcggcgaggcccctccgcccccacgtccgctgctgctccccg
gccgccgcctccaccacgaagccgcccccgcccccacctcaggaccgccgccgccgaagc
gcctcctcgtcctcgtcctccacctccgaccgcgaatccatccgcgccattcgcctcaaa
aaggttgaggagctgagagggaagggctacgagccgtacgcgtacaagtgggacaggact
cacactaccaaggagcttcaggatgggtacacccatctcgagaatggcgaggtctgcgcg
gacgtggcggtgtccattgctgggaggattgtcgcccgaagagcgtttggaaagcttgtt
tttatgaccgtaagagacgattccgggactattcagctttactgtgagaaagacagcctt
actgaggaacagtttgaacaactgaagacaattattgatattggtgatataataggtgca
aatggttccataaagaagacagaaaaaggggaactatctgtttacgtgaaaaactttgaa
atccttacaaaatccttactcccactacctgataagtaccatggcttaactgatgtggac
aagcggtatcgccaaaggtatgttgacatgattgcaaatcctgaggttgctgatgtattc
cgaacaagagcaaaggctgtatctgaaatccgcaagacaatggaatcatttggcttcata
gaagttgaaacgccagttctacagggagcagcaggtggtgctgaagcaagaccatttata
acccaccataactcactgcaaagagatctttacttgaggattgcaacagagctgcatttg
aaaaggatgctggttggagggcttgagaaagtttatgagattgggagaatatttcggaat
gaaggcatttccactcgccataatcctgaatttaccacaattgagatgtatgaagcctat
tcagactatgaaagcatgatgaatttggctgaagaaattgttactagatgtgcaatggct
actcatggcaaacttagggttgattatcagggaactgaaatctcccttgaaagaccatgg
aggagggaaaccatgcattctcttgtcaaagaagcaactggaattgactttaatagcttt
ggagaagatcttgaatccgccaaaaatgctgcaagagggatcaaaacagagagcaatgag
aatatctcattgcaagcttgttcatctgttggacatgttctcaatgaggtctttgagact
gttgttgaatcaagtctggtacagccaacatttgttcttgactacccagttgagatatca
ccattggccaaaccacataggaggtatgctggtcttaccgagcgatttgaacttttcata
tgtggtcgtgagattggtaatgcattttctgagctcacagacccaattgatcagaggggt
cgttttgaaaatcaaattaagcagcacaatgctaagcgtgctgcaatgaccaaggaggtc
aaatctactgagggtaaacacgaggaagatgatttttcgtatgaagttaccttagatgaa
gacttcctgacttccctagagtacggaatgccacctgcttccggaatgggccttggaatc
gaccgactagtaatgcttttgaccaactcggcgagtataagggatgttattgcctttcca
gtcctaaagattcaacaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333345
Entry
4333345           CDS       T01015                                 
Name
(RefSeq) lysine--tRNA ligase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4333345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4333345
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4333345
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     4333345
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4333345
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4333345
 Prokaryotic type
   Other AARSs
    4333345
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d PGBA_C
Other DBs
NCBI-GeneID: 4333345
NCBI-ProteinID: XP_015631466
UniProt: Q6F2U9
LinkDB
Position
3:complement(21665278..21673588)
AA seq 602 aa
MAESGSSGLEEKLAGLSAGCGEEPQQLSKNAKKREEKRKKQEEERRLKEEEKKKKAAATA
AASGEPPKESAADDEEMDPTQYYENRLKALDSLKATGVNPYPHKFLANITVADYIEKYKS
MNVGDKLVDVTECLAGRIMTKRAQSSKLLFYDLYGGGEKVQVFADARTSELEDNEFIKFH
STLKRGDIVGVCGYPGKSKRGELSIFPKKIVVLSPCLHMMPRQKSEGSAVPTPWAPGMGR
NIEKYVLRDQETRYRQRYLDLMVNHEVRHIFKTRSKVVSFIRKFLDGLDFLEVETPMMNM
IAGGAAARPFVTHHNELNMRLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNP
EFTTCEFYMAYADYNDLIELTETMLSGMVKELTGGYKIKYHANGVEKPPIEIDFTPPFRK
IDMIEELEAMAKLNIPKDLSSDEANKYLIDACAKYDVKCPPPQTTTRLLDKLVGHFLEET
CVNPTFIINHPEIMSPLAKWHRSRPGLTERFELFVNKHEVCNAYTELNDPVVQRQRFEEQ
LKDRQSGDDEAMALDETFCTALEYGLPPTGGWGLGIDRLTMLLTDSQNIKEVLLFPAMKP
QD
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggcggagtcgggctcgtcgggcctggaggagaagctggcgggtctctccgcgggctgc
ggcgaggagccgcagcagctctcgaagaatgccaagaagagggaggagaaaaggaagaag
caggaggaggagcgccggttgaaggaggaagagaagaagaagaaggccgctgcaacagca
gctgctagtggagagcccccgaaggaatctgccgccgacgatgaggaaatggatcccact
caatattatgagaatcgcctcaaggcacttgattcactcaaggccacgggtgtaaacccc
tatccccataagttcctggctaatattaccgtagccgattatattgagaaatacaagagc
atgaatgttggggataagcttgttgacgtcaccgagtgcctagcagggaggatcatgacc
aagagagcgcaatcttccaagctcttattttatgatctttatggtggtggtgagaaagtt
caagtttttgctgatgccaggacctcagagttggaagataatgaattcattaagtttcac
tctactctgaaacgaggtgatattgttggtgtatgtggttatccaggaaagagcaagaga
ggggagctcagtatattcccaaagaaaattgttgtgctctccccatgccttcatatgatg
cctcgacagaagagtgagggaagtgctgttcccactccatgggctccaggaatgggtagg
aacatcgaaaagtatgttttgagggaccaggaaacccgatatcgtcaacgatatcttgat
ctcatggtaaaccatgaagtgaggcatattttcaagacaagatcaaaagttgtctctttt
attcggaaatttcttgatggtcttgactttttagaggtggagactccaatgatgaacatg
attgcaggtggagcagctgcaaggccttttgtcacacatcataatgagttaaacatgagg
ctttatatgcgtattgctcctgagctctatctgaaggaattggttgttggggggctggat
cgtgtttatgaaattgggaagcagttcaggaatgaaggaattgacctgacgcacaatcct
gaattcacaacatgtgaattttatatggcatatgcagattacaatgacttgatagagctt
actgaaaccatgttatctggtatggttaaggagttgacaggtggctacaagattaaatat
catgctaacggagttgagaaaccaccaatagagattgatttcacacctcccttcagaaag
atagacatgattgaagaattagaggctatggctaaactcaatatacctaaagatctctca
agtgatgaagcaaacaagtatttgatagatgcctgtgccaaatatgatgtcaaatgccca
cctccccagactacaacacggttgcttgataagctagttggccatttcttggaggagaca
tgtgtgaatcccacgtttattatcaaccatccagagataatgagtccattggcaaagtgg
cataggtctcgacctggattgactgagaggtttgagctctttgttaacaagcatgaggtg
tgcaatgcatatacagagttaaatgatcctgttgttcagaggcaacggtttgaggaacaa
ctaaaggatcgtcaatctggtgatgatgaagctatggcattggatgaaacattctgcaca
gcccttgagtatggcctaccaccgactggtggttggggattgggaattgatcgccttaca
atgttgctgactgattctcagaatatcaaggaagttcttctattcccggctatgaagcct
caagattag

DBGET integrated database retrieval system