KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330034
Entry
4330034           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K13064  phenylalanine/tyrosine ammonia-lyase [EC:4.3.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4330034
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4330034
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.25  phenylalanine/tyrosine ammonia-lyase
     4330034
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 4330034
NCBI-ProteinID: XP_015625120
UniProt: P14717
LinkDB
Position
2:complement(24973427..24977331)
AA seq 701 aa
MAGNGPINKEDPLNWGAAAAEMAGSHLDEVKRMVAQFREPLVKIQGATLRVGQVAAVAQA
KDAAGVAVELDEEARPRVKASSEWILNCIAHGGDIYGVTTGFGGTSHRRTKDGPALQVEL
LRHLNAGIFGTGSDGHTLPSETVRAAMLVRINTLLQGYSGIRFEILEAITKLLNTGVTPC
LPLRGTITASGDLVPLSYIAGLITGRPNAQAISPDGRKVDAAEAFKLAGIEGGFFTLNPK
EGLAIVNGTSVGSALAATVMFDANILAVLSEVLSAVFCEVMNGKPEYTDHLTHKLKHHPG
SIEAAAIMEHILAGSSFMSHAKKVNEMDPLLKPKQDRYALRTSPQWLGPQIEVIRAATKS
IEREVNSVNDNPVIDVHRGKALHGGNFQGTPIGVSMDNARLAIANIGKLMFAQFSELVNE
FYNNGLTSNLAGSRNPSLDYGFKGTEIAMASYCSELQYLANPITNHVQSAEQHNQDVNSL
GLVSARKTLEAVDILKLMTSTYIVALCQAVDLRHLEENIKSSVKNCVTQVAKKVLTMNPT
GDLSSARFSEKNLLTAIDREAVFSYADDPCSANYPLMQKLRAVLVEHALTSGDAEPEASV
FSKITKFEEELRSALPREIEAARVAVANGTAPVANRIVESRSFPLYRFVREELGCVFLTG
EKLKSPGEECNKVFLGISQGKLIDPMLDCLKEWNGEPLPIN
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcgggcaacgggccgatcaacaaggaggacccgctcaactggggcgcggcggcggcc
gagatggccggcagccacctcgacgaggtgaagcgcatggtggcgcagttccgcgagccg
ctggtcaagatccagggcgccaccctccgcgtcggccaggtggccgccgtcgcccaggcc
aaggacgccgccggcgtcgccgtcgagctcgacgaggaggcccgcccccgcgtcaaggcc
agcagcgagtggatcctcaactgcatcgcccacggcggcgacatctacggcgtcaccacc
ggcttcggcggcacctcccaccgccgcaccaaggacggccccgccctccaagtcgagctc
ctcaggcatctcaacgccggaatcttcggcactggctccgatggccacacgctgccgtcg
gagacggtgcgggcggccatgctcgtgcgcatcaacaccctcctccagggctactccggc
atccggttcgagatcctcgaggccatcaccaagctgctcaacaccggcgtcacgccgtgc
ctgccgctccgtggcaccatcaccgcgtccggtgacctggttcccctgtcctacattgcc
ggcctcatcaccggccgccccaacgcgcaggccatctcgcccgacggcaggaaggtggac
gccgccgaggcgttcaagctcgccggcatcgagggtggcttcttcacgctgaaccccaag
gaaggtctcgccatcgtcaatggcacgtccgtggggtcggcgctcgcggccaccgtgatg
ttcgacgccaacatcctcgccgtcctgtccgaggtgctctcggcggtgttctgcgaggtg
atgaacggcaagccggagtacaccgaccacctgacccacaagctgaagcaccaccctggg
tcgatcgaggccgccgccatcatggagcacatcctcgccgggagctcgttcatgagccac
gccaagaaggtgaacgagatggacccgctgctgaagccgaagcaggacaggtacgcgctc
cgcacgtcgccgcagtggctcggcccgcagatcgaggtcatccgcgccgccaccaagtcc
atcgagcgcgaggtcaactccgtgaacgacaacccggtgatcgacgtccaccgcggcaag
gcgctccacggcggcaacttccagggcacccccatcggtgtgtccatggacaacgcccgt
ctcgccatcgccaacatcggcaagctcatgttcgcgcagttctccgagctcgtgaacgag
ttctacaacaacgggctgacctccaacctggccggcagccgcaacccgagcttggactac
gggttcaagggcaccgagatcgccatggcctcctactgctctgagctccagtacctcgcc
aaccccatcaccaaccatgtccagagcgcggagcagcacaaccaggacgtgaactcgctg
ggtctcgtctcggccaggaagaccctggaggcggtggacatcctcaagctcatgacctcc
acctacatcgtcgccctgtgccaggccgtcgaccttcgccacctcgaggagaacatcaag
agctccgtcaagaactgcgtcacccaggtggccaagaaggtgctcaccatgaaccccacc
ggcgacctctccagcgcgcgcttcagcgagaagaacctcctcaccgccatcgaccgcgag
gccgtgttcagctatgccgacgacccgtgcagcgccaactacccgctcatgcagaagctc
cgcgccgtgctcgtcgagcacgccctcaccagcggcgacgccgagcccgaggcctccgtg
ttctccaagatcaccaagttcgaggaggagctccgctctgcgctgccccgggagatcgag
gccgcccgcgtcgccgtcgccaacggcaccgcccccgtcgccaaccggatcgtcgagagc
cggtcgttcccgctctaccgcttcgtccgcgaggagctcggctgcgtattcctcaccggc
gagaagctcaagtcccccggcgaggagtgcaacaaggtgttcctcggcatcagccagggc
aagctcatcgaccccatgctcgactgcctcaaggagtggaacggcgagccccttcccatc
aactaa

DBGET integrated database retrieval system