KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330036
Entry
4330036           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4330036
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4330036
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4330036
SSDB
Motif
Pfam: Lyase_aromatic Sel_put
Other DBs
NCBI-GeneID: 4330036
NCBI-ProteinID: XP_015625125
UniProt: Q6K6Q1 A3A985
LinkDB
Position
2:complement(24985291..24989400)
AA seq 718 aa
MECETGLVRSLNGDGLCMSSVSAPPRADPLNWGKAADELAGSHLDEVKRMVEDFRQPLVK
IEGASLTIAQVAAVAAGAGDARVELDESARGRVKASSDWVMNSMMNGTDSYGVTTGFGAT
SHRRTKEGGALQRELIRFLNAGAFGTGTDGHVLPAEATRAAMLVRINTLLQGYSGIRFEI
LEAITKLLNANVTPCLPLRGTITASGDLVPLSYIAGLITGRQNSVAVAPDGRKVTAAEAF
KIAGIEHGFFELQPKEGLAMVNGTAVGSGLASTVLFEANVLAILAEVLSAVFCEVMTGKP
EYTDHLTHKLKHHPGQIEAAAIMEHILEGSSYMKLAKKLGELDPLMKPKQDRYALRTSPQ
WLGPQIEVIRFATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLALAA
IGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTN
HVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAIDLRHLEENMKTAVKN
CVMQVAKKSLSMNHMGGLHIARFCEKDLLTAIDREAVFAYADDPCSANYPLMQKLRAVLI
EHALANGDAERVLETSIFAKVAEFEQHVRAALPKEVEAARAAVENGTPLVPNRIKECRSY
PLYRFVREEVGTEYLTGEKTRSPGEELNKVLVAINERKHIDPLLECLKEWNGAPLPLC
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggagtgcgaaaccgggcttgttcgttccctgaacggcgacgggctgtgcatgtcgtcg
gtgtcggcgccgccgcgggccgacccactgaactgggggaaggcggcggacgagctggcg
gggagccacctcgacgaggtgaagcggatggtggaggacttccgccagccgctggtgaag
atcgagggcgccagcctgacgatcgcgcaggtggccgccgtggccgccggcgccggcgac
gccagggtggagctcgacgagtccgcccgcggccgcgtcaaggccagcagcgactgggtc
atgaacagcatgatgaacggcaccgacagctacggcgtcaccaccggcttcggcgccacc
tcccaccgccgcaccaaggagggcggcgcgctccagagggagctcatcagattcctcaat
gccggcgccttcggcaccggcaccgacggccacgttctgccggcggaggcgacgcgcgcg
gcgatgctcgtccgcatcaacaccctcctccagggttactccggcatccgcttcgagatc
ctcgaggccatcaccaagctgctcaatgccaacgtcacgccgtgcctgccgctccggggc
accatcaccgcctccggtgacttggtcccactgtcctacattgccggcctcatcaccggc
cgccagaactccgtggccgtcgccccggatggccgcaaggtgaccgccgccgaggcattc
aagattgccggcattgagcacggcttcttcgagttgcagcctaaggaaggtcttgccatg
gtgaacggcactgccgtcggctctggccttgcatcgaccgtgctctttgaggccaacgtc
cttgccatcctcgccgaggtcctgtccgccgtgttctgtgaggtcatgaccggcaagccg
gagtacaccgaccacctgacacacaagctgaagcaccaccctggacagatcgaggctgcc
gccatcatggagcacatcttggaaggcagctcgtacatgaagctggcgaagaagctcggc
gagctcgacccgttgatgaagccgaagcaggacaggtacgcgctccgcacgtcgccgcag
tggctcggcccacagatcgaggtcatccgcttcgccaccaagtcgatcgagcgcgagatc
aactccgtcaacgacaacccgctgatcgatgtctcccgtggcaaggcgcttcacggtggc
aacttccagggcacgcccatcggcgtgtccatggacaacacccgcctcgccctcgctgcc
atcggcaagctcatgttcgcgcagttctctgagctcgtgaacgacttctacaacaacggg
cttccttccaacctgtccggtggacgcaaccccagcttggactatgggttcaagggcgcg
gagatcgccatggcgtcgtactgctccgagctccagttcttgggcaacccggtgaccaac
catgtccagagcgcggagcagcacaaccaggacgtgaactcgcttggtctcatctcctcc
aggaagaccgccgaggccatcgacatcctgaagctcatgtcctccacgttcttgatcgcc
ctgtgccaagccatcgacctgcgccacctcgaggagaacatgaagaccgcggtgaagaac
tgcgtgatgcaggtggccaagaaatccctgagcatgaaccacatgggcggcctccacatc
gctcgcttctgcgagaaggacctgctcaccgcgatcgaccgcgaggccgtgttcgcctac
gccgacgacccctgcagcgccaactacccgttgatgcagaagctccgcgcggtgctcatc
gagcacgcgctcgccaacggcgacgccgagcgcgtcctggagacctccatcttcgccaag
gtggccgagttcgagcagcacgtccgcgccgcgctgcccaaggaggtggaggccgcccgc
gccgccgtcgagaacggcaccccgctcgtccccaaccggatcaaggagtgccgctcgtac
ccgctctaccggttcgtgcgcgaggaggtcggcaccgagtacctcaccggcgagaagacg
cggtcgcccggcgaggagctgaacaaggtgctcgtcgccatcaacgagcgcaagcacatc
gacccgctgctcgaatgcctcaaggaatggaatggcgcgccactgccactctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330037
Entry
4330037           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4330037
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4330037
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4330037
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 4330037
NCBI-ProteinID: XP_015625126
UniProt: A0A8I3B236
LinkDB
Position
2:complement(24992879..24995421)
AA seq 713 aa
MACENGQVAADGINGLCMAAPRADPLNWGKAAEEMSGSHLDEVKRMVAEYRQPLVKIEGA
SLRIAQVAAVAAAGEARVELDESARERVKASSDWVMNSMMNGTDSYGVTTGFGATSHRRT
KEGGALQRELIRFLNAGAFGTGTDGHVLSAEATRAAMLVRINTLLQGYSGIRFEILEAIT
KLLNANVTPCLPLRGTVTASGDLVPLSYIAGLVTGRENSVAVAPDGSKVNAAEAFKIAGI
QGGFFELQPKEGLAMVNGTAVGSGLASTVLFEANILAVLAEVLSAVFCEVMNGKPEYTDH
LTHKLKHHPGQIEAAAIMEHILEGSSYMKLAKKLGELDPLMKPKQDRYALRTSPQWLGPQ
IEVIRAATKSIEREINSVNDNPLIDVSRDKALHGGNFQGTPIGVSMDNTRLAIAAIGKLM
FAQFSELVNDYYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHVQSA
EQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVALCQAIDLRQIEENVKSAVKSCVMTV
ARKTLSTSATGGLHAARFCEKDLLQEIDREAVFAYADDPCSANYPLMKKLRNVLVERALA
NGAAEFNAETSVFAKVAQFEEELRAALPAAVLAARAAVENGTAATPNRITECRSYPLYRF
VREELGTAYLTGEKTRSPGEELNKVLVAINQGKHIDPLLECLKEWNGAPLPIC
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggcgtgcgagaacggtcaggttgctgccgatggcatcaacggcctctgcatggcggcg
ccccgcgccgacccgctgaactgggggaaggcggcggaggagatgtcggggagccacctc
gacgaggtgaagcgcatggtggccgagtaccgccagccgctggtaaagatcgagggcgcc
agcctgaggatcgcgcaggtcgccgcggtggccgcggccggcgaggccagggtcgagctc
gacgagtcggcccgcgagcgcgtcaaggccagcagcgactgggtgatgaacagcatgatg
aacggcacggacagctacggtgtcaccaccggcttcggcgccacgtcccacaggaggacc
aaggaaggtggtgccctgcaaagagagctcatcaggttcctcaatgccggcgccttcggc
acgggcacggacggccacgtcctgtccgccgaggccacgcgcgcggcgatgctcgtccgc
atcaacactctcctccagggctactcaggcatccgcttcgagatcctcgaggcgattacc
aagctgctcaatgccaacgtcacgccatgcctgccactcaggggcacggttaccgcgtcc
ggcgacctggtcccgctctcctacattgccggcttggtcaccggccgcgagaactctgtc
gcggtcgctcctgatggcagcaaggtgaacgccgctgaggcgtttaagattgctggcatc
caaggtggcttcttcgagttgcagcccaaggaaggtctcgccatggtgaatggcactgcc
gtcggctctggacttgcctccacggtgctctttgaggcgaacattcttgctgtccttgcc
gaggtcctgtccgccgtgttctgcgaggtgatgaacggcaagccggagtacaccgaccac
ctgacacacaagctgaagcaccaccctggacagatcgaggctgctgccatcatggagcac
atcttggaaggcagctcgtacatgaagctggcgaagaagctcggtgagctcgacccgttg
atgaagccgaagcaagaccggtacgcgctccgcacgtcgccgcaatggcttggccctcag
atcgaagttattcgtgcggccaccaagtccattgagcgcgagatcaactctgtcaatgac
aacccactcattgatgtctcccgcgacaaggcgcttcatggtggtaacttccagggcact
cccatcggtgtgtccatggacaacactcgcctcgcaattgctgccatcggcaagctcatg
ttcgcgcagttctcagagcttgtgaacgactactacaacaacggccttccctccaacctg
tccggcgggcgcaacccgagcttggattacggcttcaagggcgccgagatcgccatggct
tcgtactgctccgagttgcagttcttgggcaacccagtgaccaaccacgtccagagcgcg
gagcagcacaaccaggacgtcaactccctcggcctcatctcctccaggaagacagccgag
gccgtcgaaatcctgaagctcatgtcctccacgttcttggtcgccctgtgccaggccatc
gacctgcggcaaatcgaggagaacgtcaagagcgccgtcaagagctgcgtcatgacagtg
gccaggaagactctgagcacgagcgccaccggcggtctccacgccgctcgcttctgcgag
aaggatcttctccaggagatcgaccgcgaagccgtgttcgcgtacgccgacgacccgtgc
agcgccaactacccgctgatgaagaagctccggaacgtgcttgtggagcgcgccctcgcc
aacggcgcggccgagttcaacgccgagacctcggtgttcgccaaggtcgcccagttcgag
gaggagctccgcgcggcgctgccagcggcggtgttggccgcacgggcagctgtggagaac
ggcacggcggcaacgcccaacagaatcaccgagtgccgctcctacccactgtaccggttt
gtgcgcgaggagctcggaaccgcgtacctcaccggcgagaagacgcggtcgcccggcgag
gagctgaacaaggtgctcgtcgccatcaaccaaggcaagcacattgatccgctgcttgag
tgtctcaaggagtggaacggcgcgcccctgcccatctgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330040
Entry
4330040           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4330040
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4330040
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4330040
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 4330040
NCBI-ProteinID: XP_015626729
UniProt: Q0DZE0 B7EFQ4
LinkDB
Position
2:complement(25006493..25009135)
AA seq 713 aa
MECENGRVSANGMSGLCVAAPRADPLNWGKATEEMTGSHLDEVKRMVAEYRQPLVKIEGA
SLRIAQVAAVAAAGEARVELDESARERVKASSDWVMNSMMNGTDSYGVTTGFGATSHRRT
KEGGALQRELIRFLNAGAFGTGTDGHVLPAEATRAAMLVRINTLLQGYSGIRFEILEAIA
KLLNANVTPCLPLRGTITASGDLVPLSYIAGLVTGRENAVAVAPDGSKVNAAEAFKIAGI
QGGFFELQPKEGLAMVNGTAVGSGLASTVLFEANILAILAEVLSAVFCEVMNGKPEYTDH
LTHKLKHHPGQIEAAAIMEHILEGSSYMKHAKKLGELDPLMKPKQDRYALRTSPQWLGPQ
IEVIRAATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLAIAAIGKLM
FAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHVQSA
EQHNQDVNSLGLISSRKTDEAIDILKLMSSTFLIALCQAVDLRHIEENVKSAVKSCVMTV
AKKTLSTNSTGDLHVARFCEKDLLKEIDREAVFAYADDPCSHNYPLMKKLRNVLVERALA
NGAAEFNADTSVFAKVAQFEEELRATLPGAIEAARAAVENGTAAIPSRITECRSYPLYRF
VREELGTKYLTGEKTRSPGEELNKVLVAINEGKHIDPLLECLKEWNGEPLPIC
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggagtgcgagaacggccgcgtttctgccaatggcatgagtggtctctgcgtcgcggcg
ccccgcgccgacccgctgaactgggggaaggccacggaggagatgacggggagccacctc
gacgaggtgaagaggatggtggcggagtaccgccagcctctggtcaagatcgagggcgct
agcctgaggatcgcgcaggtcgccgcggtggccgcggccggcgaggccagggtggagctc
gacgagtcggcccgcgagcgcgtcaaggccagcagcgactgggtgatgaacagcatgatg
aacggcacggacagctacggtgtcaccaccggtttcggcgccacgtcccacaggaggacc
aaggagggtggtgctctgcaaagagagctcatcagattcctcaatgccggcgcgttcggc
actggcaccgacggtcatgttttgccggcggaggcaacccgcgcggcaatgctcgtccgc
atcaacacactcctccagggatactccggcatccggttcgagatcctcgaggcgatcgcc
aagctgctcaacgcgaacgtcacaccgtgcctgccgctccggggcacgatcaccgcctcc
ggtgacctcgtcccgctgtcctacattgccggccttgtcactgggcgcgagaacgccgtg
gcggttgcaccagatggcagcaaggtgaacgccgctgaggcgttcaagattgctggcatc
cagggcggcttcttcgagctgcagcccaaggaaggccttgccatggtcaatggcactgcc
gtgggctctggccttgcatcgaccgtgctctttgaggctaacattcttgccatcctcgcc
gaggtcctctcggccgtgttctgcgaggtgatgaacggcaagccggagtacaccgaccac
ctgactcacaagctcaagcaccatccaggacagatcgaggccgccgccatcatggagcac
atcttggagggaagctcctacatgaagcatgccaagaagcttggtgagctcgacccactg
atgaagccgaagcaagaccggtacgcgctccggacatccccacagtggctcggccctcaa
attgaggttatccgcgccgccaccaagtccatcgagcgtgagatcaactccgtgaacgac
aacccgctcatcgacgtctcccgcggcaaggcgctgcacggtggcaacttccagggcacg
cccatcggcgtgtccatggacaacacccgcctcgccatcgctgccatcggcaagctcatg
ttcgcgcagttctcggagctcgtgaacgacttctacaacaacggcctgccatccaacctg
tctggcggtcgcaacccgagcttggactacgggttcaagggcgccgagatcgccatggcc
tcctactgctccgagctgcagttcttgggcaacccagtgaccaaccacgtccagagcgcc
gagcagcacaaccaggacgtcaactctcttggactcatctcctccaggaagaccgacgag
gcaatcgacatcctgaagctcatgtcctccacgttcttgatcgccctctgccaggccgtc
gacctgcggcacatcgaggagaacgtcaagagcgccgtcaagagctgcgtcatgacggtg
gccaagaagacactcagcaccaactccaccggcgatctccacgtcgcacgcttctgcgag
aaggacctgctcaaggagatcgaccgcgaggcggtgttcgcgtacgcggacgacccgtgc
agccacaactacccgctgatgaagaagctgcgcaacgtgctcgtggagcgcgccctcgcc
aacggcgcggccgagttcaacgccgacacctcggtgttcgccaaggtcgcgcagttcgag
gaggagctgcgcgcgactctgccaggtgcgatcgaggccgcacgtgcggctgtggagaac
ggcacggcggcgattcccagcagaatcaccgagtgcaggtcgtatccgctctaccggttc
gtgcgcgaggagctcggaacaaagtacctgaccggcgagaagacacgatcgcctggcgag
gagctgaacaaggttcttgtggctatcaacgaaggcaagcacatcgacccgttgctcgag
tgcctcaaggagtggaacggcgagcccctgccaatctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336415
Entry
4336415           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4336415
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4336415
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4336415
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 4336415
NCBI-ProteinID: XP_015633749
UniProt: B9FK75 Q7X8V3
LinkDB
Position
4:complement(25927051..25929746)
AA seq 714 aa
MECENGHVAAAANGSSLCVAKPRADPLNWGKAAEELSGSHLDAVKRMVEEYRRPVVTIEG
ASLTIAQVAAVASAGAARVELDESARGRVKASSDWVMNSMMNGTDSYGVTTGFGATSHRR
TKEGGALQRELIRFLNAGAFGNGDDGHVLPAAATRAAMLVRINTLLQGYSGIRFEILETI
ATLLNANVTPCLPLRGTITASGDLVPLSYIAGLVTGRPNSVAVTPDGRKVDAAEAFKIAG
IQHGFFELQPKEGLAMVNGTAVGSGLASMVLFEANVLGVLAEVLSAVFCEVMNGKPEYTD
HLTHKLKHHPGQIEAAAIMEHILEGSSYMMLAKKLGELDPLMKPKQDRYALRTSPQWLGP
QIEVIRAATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLAIAAIGKL
MFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQS
AEQHNQDVNSLGLISSRKTAEAIDVLKLMSSTFLIALCQAIDLRHLEENVRSAVKGCVTT
VARKTLSTSATGDLHKARFCEKDLLQAIDREAVFAYADDPCSANYPLMQKMRAVLIEHAL
ANGEAERNVDTSVFAKVATFEEELRVALPREVEAARAAVENGTAAKANRITECRSYPLYR
FVREELGTEYLTGEKTRSPGEEVNKVFVAMNQGKHIDALLECLKEWNGEPLPIC
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggagtgcgagaacgggcacgtcgccgccgccgccaacggcagcagcctgtgcgtggct
aagccgcgtgccgacccgctcaactgggggaaggcggcggaggagctgtccgggagccat
ctggacgcggtgaagcgcatggtggaggagtaccgcaggcccgtggtgacgatcgagggc
gccagcctgaccatcgcgcaggtcgcggcggtggcctccgccggcgccgccagggtggag
ctcgacgagtccgcccgcggccgcgtcaaggccagcagcgactgggtcatgaacagcatg
atgaacggcaccgacagctacggcgtcaccaccggcttcggcgccacctcccaccggagg
accaaggagggcggcgcgctccagcgagagcttatccggtttcttaatgccggggcgttc
ggcaacggcgacgacggccacgtgctgccggccgcggcgacgcgggcagccatgctcgtc
cgcatcaacactctgctccaggggtactctggcatccggttcgagatcctcgagacgatc
gccacgctgcttaacgccaacgtgacgccgtgcttgccgctccggggcacgatcaccgcg
tccggcgacctcgtcccgctctcctacatcgcgggactcgtcaccggccgaccaaactct
gtggcggtgacgcccgatggcaggaaggtggatgccgcggaggcgttcaagatcgccggc
atccagcacggcttcttcgagctccagcccaaggaaggcctcgccatggtgaacggcacg
gccgtcggctccgggctcgcctcgatggtgctctttgaggcgaacgtccttggcgtgctc
gcggaggtcctctccgcggtgttctgcgaggtcatgaacggcaagccggagtacaccgac
cacctgacgcacaagcttaagcaccacccgggacagattgaggcagccgccattatggag
cacatcttggaggggagctcctacatgatgctggcgaagaagctcggcgagctcgacccg
ctgatgaagcccaagcaagacaggtacgcgctccgcacgtcgccgcaatggctcggcccc
cagattgaggtcatccgtgccgccaccaagtcgatcgagcgcgagatcaactccgtcaac
gacaacccgctcattgacgtctcccgtggcaaggcgctccacggcggcaacttccagggc
acacccatcggcgtgtccatggacaacaccaggctcgccattgccgcgatcggtaagctc
atgttcgcgcagttctctgagctcgtgaacgatttctacaacaacggcctgccgtccaac
ctgtccggtgggcgcaacccgagcttggactacggcttcaagggtgccgagatcgccatg
gcatcgtactgctctgagctccagttcttggccaaccctgtgaccaaccatgtccagagc
gcggagcagcacaaccaagacgtcaactctctcggcctcatctcgtccaggaagacggcc
gaggccatcgacgtgctcaagctcatgtcctcgacgttcttgatcgcgctatgccaggcc
atcgacctgcgccacctcgaagagaacgtcaggagcgccgtcaagggctgcgtgacgacg
gtggcgaggaagaccctgagcaccagcgccaccggcgacctccacaaggcccggttctgc
gagaaggacctgctccaggcgatcgaccgcgaggccgtgttcgcgtacgcggacgacccc
tgcagcgccaactacccgctgatgcagaagatgcgcgccgtcctcatcgagcacgcgctg
gccaacggcgaggcggagcgcaacgtcgacacctcggtgttcgccaaggtcgcgacgttc
gaggaggagctccgcgtggcgctgcccagggaggtggaggctgcccgtgcggccgtggag
aacggcaccgccgcaaaggcgaacaggatcaccgagtgcaggtcgtacccgctctaccgg
ttcgtccgcgaggagctcgggacagagtacttgaccggggagaagacgcggtcgcccggc
gaggaggtgaacaaggtgttcgtcgccatgaaccagggcaagcacatcgacgcactgctc
gagtgcctcaaggagtggaacggcgagcctctgcccatctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338861
Entry
4338861           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4338861
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4338861
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4338861
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 4338861
NCBI-ProteinID: XP_015640196
UniProt: Q0DI01
LinkDB
Position
5:complement(20953409..20955934)
AA seq 716 aa
MECETGYVAAAADGGLCMEVPRADPLNWGKAAEEMAGSHLDEVKRMVAEYRQPVVRIEGA
SLRIAQVAAVAGAGDGEAAMVELDESARERVKASSDWVMNSMANGTDSYGVTTGFGATSH
RRTKEGGALQRELIRFLNAGAFGTGADGHVLPAGATRAAMLVRINTLLQGYSGIRFEILE
AVAKLLNANVTPCLPLRGTITASGDLVPLSYIAGLVTGRENSVAVAPDGRKVNAAEAFKI
AGIQGGFFELQPKEGLAMVNGTAVGSGLASTVLFEANVLAILAEVLSAVFCEVMNGKPEY
TDHLTHKLKHHPGQIEAAAIMEHILEGSSYMKEAKRLGELDPLMKPKQDRYALRTSPQWL
GPQIEVIRAATKSIEREINSVNDNPLIDVSRGKALHGGNFQGTPIGVSMDNTRLAIAAIG
KLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHV
QSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLVALCQAIDLRHIEENVKGAVKTCV
MTVAKKTLSTNSTGGLHVARFCEKDLLSEIDREAVFAYADDPCSANYPLMKKLRSVLVER
ALANGAAEFDAETSVLAKVARFEEELRAALPRAVEAARAAVESGTAAAPNRIAECRSYPL
YRFVREELGTAYLTGEKTRSPGEELNKVLVAINQGKHIDPLLECLKEWNGAPLPIC
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggagtgcgagactggctacgtcgccgcggccgccgatggtggtctctgcatggaggtg
ccccgcgccgacccgctcaactgggggaaggcggcggaggagatggccgggagccacctc
gacgaggtgaagaggatggtggcggagtaccggcagcccgtggtgcggatcgagggcgcc
agcctgaggatcgcgcaggtggcggcggttgccggcgccggcgacggcgaggccgccatg
gtcgagctcgacgagtcggcgcgggagcgcgtcaaggccagcagcgactgggtgatgaac
agcatggcgaacggcaccgacagctacggcgtcaccaccgggttcggcgccacgtcgcac
cggcggaccaaggagggcggcgcgctgcagcgggagctcatcaggttcctcaacgccggc
gccttcggcaccggcgccgacggccacgtcctccccgcgggtgccacgcgcgcggcgatg
ctcgtccggatcaacaccctgctgcaaggctactccggcatccggttcgagatcctcgag
gcggtcgccaagctgctcaacgccaacgtcacgccgtgcctgccgctccggggcacgatc
accgcgtcgggcgacctcgtcccgctctcctacatcgccgggctcgtcaccggccgggag
aactccgtcgcggtggcgcccgacggcaggaaggtgaacgccgccgaggcgttcaagatc
gccggcatccagggcggcttcttcgagctgcagcccaaggaaggcctcgccatggtgaac
gggacggccgtgggctccggcctcgcctccaccgtgctgttcgaggccaacgtcctcgcc
atcctcgccgaggtgctctccgccgtgttctgcgaggtgatgaacggcaagccggagtac
accgaccacctcacccacaagctgaagcaccacccggggcagatcgaggcggccgccatc
atggagcacatcttggaaggcagctcgtacatgaaggaggcgaagaggctcggcgagctc
gacccgctgatgaagccgaagcaggacaggtacgcgctccggacgtcgccgcagtggctc
ggcccccagatcgaggtcatccgcgccgccaccaagtcgatcgagcgcgagatcaactcc
gtcaacgacaacccgctcatcgacgtctcccgcgggaaggcgctgcacggcggcaacttc
cagggcacccccatcggcgtgtccatggacaacacccgcctcgccatcgccgccatcggg
aagctcatgttcgcgcagttctccgagctggtgaacgacttctacaacaacggcctgccc
tccaacctctccggcggccgcaacccgagcttggactacggcttcaagggcgccgagatc
gccatggcgtcctactgctccgagctgcagttcttgggcaacccggtgaccaaccacgtc
cagagcgccgagcagcacaaccaggacgtgaactcgctgggcctcatctcctccaggaag
acggcggaggccatcgacatcctcaagctcatgtcctccaccttcctcgtcgcgctctgc
caggcgatcgacctgcgccacatcgaggagaacgtcaagggcgccgtcaagacctgcgtc
atgacggtcgccaagaagacgctgagcaccaactccaccggcggcctccacgtcgcccgc
ttctgcgagaaggacctgctcagcgagatcgaccgggaggccgtgttcgcgtacgccgac
gacccgtgcagcgccaactacccgctgatgaagaagctccgcagcgtgctcgtcgagcgc
gcgctcgccaacggcgccgccgagttcgacgcggagacctccgtgctcgccaaggtcgcg
cggttcgaggaggagctccgcgcggcgctgccccgggccgtcgaggccgcgcgcgccgcc
gtggagagcggcacggcggcggcgcccaacaggatcgccgagtgccgctcgtacccgctc
taccggttcgtgcgcgaggagctcggcaccgcctacctcaccggcgagaagacgcggtcg
cccggcgaggagctcaacaaggtgctcgtcgcgatcaaccagggcaagcacatcgacccg
ctgctcgagtgcctcaaggagtggaacggcgcgccactgccaatctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351235
Entry
4351235           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4351235
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4351235
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4351235
SSDB
Motif
Pfam: Lyase_aromatic VAD1-2
Other DBs
NCBI-GeneID: 4351235
NCBI-ProteinID: XP_015615944
UniProt: Q0IQT7 Q53NW6
LinkDB
Position
11:29012490..29014879
AA seq 700 aa
MECETGVNGSGPRGSDPLYWGKAAEGVAGSHLEEVKRMVVEYRAPLVKIDGAMLSVAKVA
AVAGEAARVQVVLDESARPRLEASREWVFESTMNGTDTYGVTTGFGGAAHRRTKEFAALQ
KELIRYLNAGVFGASRSDGYTLPTEVTRAAMLVRINTLTQGYSGIRFEILEAIAKLLNAN
VTPCLPLRGTITASGDLVPLSYIAGLITGRHNSAAVAPDGTKVDAAEAFRMAGIEHGFFA
LQPKEGLAIVNGTAVGSGLAAIVLFEANVLAVLAEVLSAVYCEVMAGNPEYTDHLIHALK
HHPGQIEAAAIMEHILEGSSYMKKLAKDKEQGQGELDRLTKLKQDRYAIRTAPQWLGPQV
EVIRFATKSIEREINSVNDNPVIDVARRKALHGGNFQGTPVGVSMDNTRLAIAAIGRLMF
SQFSELVSSFYSNGLPSNLSGGRNPSLDYGFNGAEVAMASYCSELQFLANPVTNHVQTAE
QHNQSVNSLGLISSRMTAEAVTILKLMSSTFLIALCQAVDLRQLEESIKAAVNKCVTNVA
KKSLTLAMDDDDHLLALLGAAIDRVAVFTYAEDPCRSSLPLMQKLRAVLMEHALANNGDI
LLAKVAEFEQQLRAVLPDEVEAARAAVESGTAPNRISDCRSYPLYRFVRKELGAEYLTGE
KTRSPGEEVDKVVIAMNQHKHIHPLLECLSEWKGAPLPLS
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggagtgtgagaccggtgtcaacggctcagggccgcgcggcagcgaccccttgtactgg
ggcaaggcggcagagggtgttgcggggagccacctcgaggaggtgaagaggatggtggtt
gagtaccgcgcgccgctggtgaagatcgacggcgccatgctcagcgtcgccaaggtggca
gccgtcgccggcgaggccgcccgggtgcaggtggtgctggacgaatccgcacgaccccgc
ctggaggctagccgcgagtgggttttcgaaagcaccatgaatggcaccgacacgtacggc
gtcaccaccggcttcgggggtgccgcccaccgccgcaccaaggagttcgccgcgctccag
aaagagctgatccgatacctcaacgccggcgtctttggagccagccgcagcgacggctac
acgctgccgacggaggtcacgcgcgcagccatgctcgtgcgcatcaacaccctcacccag
ggctactcgggcatccgcttcgagatcctcgaggccatcgccaagctgctcaacgccaac
gttacgccgtgcctgccgctccggggcaccatcaccgcgtccggcgacctggtccctctg
tcctacatcgccggcctaatcaccggccgccacaactccgcggcggtggccccggacggc
accaaggtggacgccgccgaggcattcaggatggccggcatcgagcacgggttcttcgcg
ttgcagcccaaggaagggctcgccatcgtcaacggcacggccgtgggctccggcctcgcg
gcgatcgtgctcttcgaggccaacgtcctcgccgtccttgccgaggtcctctcggcggtg
tactgcgaggtaatggccggcaatccggagtacaccgaccacctcatccacgcgctgaag
caccaccctggacagatcgaagctgcggccatcatggagcacatactggaaggcagctcc
tacatgaagaagcttgccaaggacaaggagcagggccagggcgagcttgaccggctgacg
aagctgaagcaggacaggtacgccatccgcacggcgccgcagtggctcggcccgcaggtc
gaggtcatccgcttcgccaccaagtccatcgagcgggagatcaactccgtcaacgacaac
ccggtcatcgacgtcgcccgccgcaaggcgctccacggcggcaacttccagggcactccc
gtcggggtgtccatggacaacactcgtctcgccatcgctgccatcggcaggctcatgttc
tcgcagttctccgagctcgtcagtagcttctacagcaacggccttccctccaacctgtcc
ggcgggcgcaacccgagcttggactacggtttcaatggcgccgaggtcgccatggcgtcc
tactgctctgagctccagttcctcgccaacccggtgaccaaccatgtgcagaccgcggag
cagcacaaccagagcgtcaactctctcggcctcatctcctccaggatgactgcagaggcc
gtcaccatcctgaagctcatgtcctctactttcctcatcgcactgtgccaggccgtcgac
ctgcgccaactcgaggagagcatcaaggccgctgttaacaagtgcgtgacgaatgtcgcc
aagaaatccctgaccctggccatggacgacgacgaccatctgctagcgctgctcggcgct
gctatcgaccgcgtggcggtgttcacgtacgcagaagacccatgcagatccagcttgcca
ctcatgcagaagctccgcgcggtgctcatggagcatgcgctggccaataacggtgacatc
ctcctggccaaggtggctgagttcgagcagcagctccgcgcggtgctccccgacgaggtg
gaggccgcacgcgccgctgtagagagcggcacggccccgaacaggatctccgactgccgc
tcgtacccgctgtacaggttcgtgcgcaaggagctcggcgccgagtacctgaccggcgag
aagacgcggtctcccggggaggaggtggacaaggtggtgatcgccatgaaccagcacaag
cacatccatccactgctggagtgcctcagcgagtggaaaggcgcgcccctgccacttagc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352358
Entry
4352358           CDS       T01015                                 
Name
(RefSeq) phenylalanine ammonia-lyase
  KO
K10775  phenylalanine ammonia-lyase [EC:4.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4352358
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4352358
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.24  phenylalanine ammonia-lyase
     4352358
SSDB
Motif
Pfam: Lyase_aromatic VAD1-2 DUF2939
Other DBs
NCBI-GeneID: 4352358
NCBI-ProteinID: XP_015620761
UniProt: A0A8J8XCI5 Q2QPR0
LinkDB
Position
12:20292874..20295408
AA seq 690 aa
MECETGLVDRPLNGDPLYWGKAAEGLAGSHLDEVKRMVVEYRAPLVKIDGAMLSVAKVAA
VAGEAARVQVVLDESARPRLEASREWVFDSTMNGTDTYGVTTGFGGAAHRRTKEFAALQK
ELIRYLNAGVFGASRSDGYTLPTEVTRAAMLVRINTLTQGYSGIRFEILEAIAKLLNANV
TPCLPLRGTITASGDLVPLSYIAGLITGRQNSAAVAPDGSKVDAAEAFRIAGIEHGFFAL
QPKEGLAIVNGTAVGSGLAAIVLFEANVLAVLAEVLSAVYCEVMAGNPEYTDHLIHALKH
HPGQIEAAAIMEHILEGSSYMRLAKEQGELDRLTKLRQDRYAIRTAPQWLGPQVEVIRFA
TKSIEREINSVNDNPVIDVARRKALHGGNFQGTPIGVSMDNTRLAIAAIGRLMFSQFSEL
ASSFYSNGLPSNLSGGRNPSLDYGFNGAEVAMASYCSELQFLANPVTNHVQTAEQHNQSV
NSLGLISSRMTAEAVTILKLMSSTFLIALCQAVDLRQLEESIKAAVNKCVTNVAKKSLAM
DDDDLLALLGAAIDRVAVFTYAEDPCRSSLPLIQKLRAVLMDHALANGDNQLAKVAEFEQ
QLRAVLHDEVEAARAAVESGTAPNRITQCRSYPLYRFVRKELGAEYLTGEKTRSPGEEVD
KVVIAMNQHKHINPLLECLSEWKGAPLPLN
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggagtgtgagaccggtctggtcgaccgtcccctcaacggcgaccccttgtactggggc
aaggcggcggagggtcttgcggggagccacctcgacgaggtgaagaggatggtggtggag
taccgcgcgccgctggtgaagatcgacggcgccatgctcagcgtcgccaaggtggcagcc
gtcgctggcgaggccgcccgggtgcaggtggtgctggacgaatccgcacgaccccgcctg
gaggctagtcgcgagtgggtcttcgacagcaccatgaacggcaccgacacgtacggcgtc
accaccggcttcggaggtgccgcccaccgccgcaccaaggagttcgccgcgctccagaaa
gagctgatccgatacctcaacgccggcgtctttggagccagccgcagcgacggctacacg
ctgccgacggaggtcactcgcgcagccatgctggtgcgcatcaacaccctcacccagggc
tactcgggcatccgcttcgagatcctcgaggccatcgccaagctgctcaacgccaacgtg
acgccgtgcctgccgctccggggcaccatcaccgcgtccggcgacctggtcccgctgtcc
tacatcgccggcctcatcaccggccgccagaactccgcggcggtggccccggacggcagc
aaggtggacgccgctgaggcgttcaggatcgccggcatcgagcacgggttcttcgcgttg
cagcccaaggaagggctcgccatcgtcaacggcacggccgtgggctccggcctcgcggcg
atcgtgctcttcgaggccaacgtcctggccgtccttgccgaggtcctctcggcggtgtac
tgcgaggtgatggccggcaatccggagtacaccgaccacctcatccacgcgctgaagcac
caccctggacagatcgaagctgcggccatcatggagcacatactggaaggcagctcctac
atgaggcttgccaaggagcagggcgagcttgaccggttgacgaagctgaggcaggacagg
tacgccatccgcacggcgccgcagtggctcggcccgcaggtcgaggtcatccgcttcgcc
accaagtcgatcgagcgggagatcaactccgtcaacgacaacccggtcatcgacgtcgcc
cgccgcaaggcgctccacggcggcaacttccagggcactcccatcggggtgtccatggac
aacactcgtctcgccatcgctgccatcggcaggctcatgttctcgcagttctccgagctt
gccagtagcttctacagcaacggccttccctccaatctgtccggcgggcgcaacccgagc
ttggactacggtttcaatggcgccgaggtcgccatggcgtcctactgctctgagctgcag
ttcctcgccaacccggtgaccaaccatgtgcagaccgcggagcagcacaaccagagcgtc
aactctctcggcctcatctcctccaggatgacagcagaggccgtcaccatcctgaagctc
atgtcctctactttcctcatcgcactgtgccaggccgtcgacctgcgccaactcgaggag
agcatcaaggccgctgttaacaagtgcgtgacaaatgtcgccaagaaatccctggccatg
gacgatgacgatctgctagcgctgctcggcgctgctatcgaccgcgtggcggtgttcacg
tacgcagaagacccatgcagatccagcttgccactcatacagaagctccgcgcggtgctc
atggaccatgcgctggccaacggtgacaaccagctggccaaggtggctgagttcgagcag
cagctccgcgcggtgctccacgacgaggtggaggccgcacgcgcggctgtggagagcggc
acggccccgaacaggatcacccagtgtcgctcgtacccgctgtacaggttcgtgcgcaag
gagctcggcgccgagtacctgaccggcgagaagacgcggtcgcccggggaggaggtggac
aaggtggtgatcgccatgaaccagcacaagcacatcaacccactgctggagtgcctcagc
gagtggaaaggcgcgcccctgccacttaattag

DBGET integrated database retrieval system