KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330075
Entry
4330075           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-2-like
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4330075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4330075
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4330075
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4330075
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4330075
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4330075
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 4330075
NCBI-ProteinID: XP_015625377
UniProt: A0A0P0VM26 Q6H852
LinkDB
Position
2:25454229..25458549
AA seq 235 aa
MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILVDET
SVQKIQSLTPNIGVVYSGMGPDFRVLVRKSRKQAQQYYRLYKETIPVTQLVRETAAVMQE
FTQSGGVRPFGVSLLIAGYDDNGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE
DMELDDAIHTAILTLKEGYEGQISANNIEIGVIRSDREFKVLTPAEIKDFLEEVE
NT seq 708 nt   +upstreamnt  +downstreamnt
atgggagacagccagtactccttctccctcaccaccttcagcccgtcggggaagctggtg
cagatcgagcacgcgctcaccgcggtcggatccggccagacgtccctcgggatcaaagct
gctaatggtgtagttatcgccactgagaagaaattgccttctattttagtcgatgaaaca
tctgtgcaaaagattcagtcattgactccgaacattggagttgtctacagtgggatgggt
cccgatttccgtgttcttgtgagaaaaagtcggaaacaagcacagcagtattatcggttg
tacaaggaaactatccctgttactcagcttgtccgagaaactgctgctgttatgcaggag
ttcacacagtctggtggtgtaagaccatttggagtatcattattgattgccgggtacgat
gacaatggcccacagctgtatcaggttgatccctcaggatcatacttctcctggaaagca
tcagctatggggaaaaatgtctccaatgcaaagacatttcttgaaaaaagatacacagaa
gacatggagcttgatgatgccatccatactgccattttgactctgaaagaaggatatgag
ggtcaaatctcagccaacaatattgaaattggagttattcgatctgaccgtgaattcaaa
gttctaaccccggcagagatcaaggatttcttggaagaggtggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333000
Entry
4333000           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4333000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4333000
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4333000
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4333000
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4333000
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4333000
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 4333000
NCBI-ProteinID: XP_015628148
UniProt: Q10KF0
LinkDB
Position
3:15420135..15424720
AA seq 235 aa
MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILVDET
SVQKIQSLTPNIGVVYSGMGPDFRVLVRKSRKQAQQYYRLYKETIPVTQLVRETAAVMQE
FTQSGGVRPFGVSLLIAGYDDNGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE
DMELDDAIHTAILTLKEGYEGQISANNIEIGIIRSDREFKVLSPAEIKDFLEEVE
NT seq 708 nt   +upstreamnt  +downstreamnt
atgggcgacagccagtactccttctccctcaccaccttcagcccgtcggggaagctggtg
cagatcgagcacgcgctgacggcggtcgggtccggccagacctccctcgggatcaaagct
gctaatggagtagttattgccaccgagaagaagttgccttctattttagtggatgaaaca
tctgtgcaaaagattcagtcgttgactccaaatattggtgttgtctacagtggcatgggg
ccagacttccgtgttttagtgaggaaaagtcgaaagcaagcacaacagtattatcgtctg
tacaaggaaactatacctgttacacagctagtccgagaaactgctgctgtcatgcaggag
tttacacaatctggtggtgtaagaccatttggtgtatctttgttgattgctgggtatgat
gacaatggtccccaattgtaccaggttgatccatcagggtcatacttctcctggaaagca
tcagctatggggaaaaatgtgtcaaatgcaaagacatttcttgagaaaagatacacagaa
gatatggagcttgacgatgccattcatactgctattttaactctgaaagaaggatatgaa
ggacaaatctccgccaacaacattgaaattgggataatccgatctgaccgtgaattcaag
gttctgagccctgcagagatcaaggatttcttggaagaggtggaataa

DBGET integrated database retrieval system