KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330090
Entry
4330090           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase-like 6
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330090
   00620 Pyruvate metabolism
    4330090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4330090
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4330090
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4330090
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4330090
NCBI-ProteinID: XP_015626479
UniProt: Q6H5W1 A0A0P0VM07
LinkDB
Position
2:complement(25565869..25569039)
AA seq 381 aa
MAAASSPAAAITCRAAVAWAPGQALVMEEVEVAPPEAMEIRVKVVSTSICRSDVTQWQST
AQTDLFPRIFGHEASGVVESVGEGVTEFEVGDHVLTVFIGECMSCKHCVSGKSNMCQKLG
LERRGVMHSDQKTRFSLRGKPVYHYCAVSSFSEYTVVHSGCAVKVGPTVPMDRICLLSCG
VSAGLGAAWKVADISKGSSVVIFGLGTVGLSVAQGAKLRGASIIIGVDTNPEKQEKGKAF
GVTDFINPEELNEPVQQVVKRLTNGGADYSFECVGDTGVVSTALQSCSDGWGLTVTLGVP
KAKPEVSAHYALLLSGRTLKGSLFGGWRPKSDLPLLVDKYANKEIQVDDLVTHDLSFDYI
NKALELMLENKCLRCVIHMPQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggccgcggcgtcgtctccggcggcggccatcacctgccgagcggcggtggcgtgggcg
cccggtcaggcgctggtgatggaggaggtggaggtggcgccgccggaggccatggagatc
cgcgtcaaggtcgtctccacctccatctgccgcagtgacgtcacccagtggcaatccacg
gctcaaaccgatctgttccccagaattttcgggcacgaagcatccggtgtggttgagagt
gttggtgaaggtgtgaccgagttcgaagtgggagaccatgtgctcaccgtcttcatcgga
gagtgcatgagctgcaagcactgcgtttcagggaagagcaacatgtgccagaagctcggc
ctggagaggaggggtgtcatgcacagcgatcagaagacccgcttctcgctcagggggaaa
cctgtgtaccattactgtgcagtgtcaagcttcagcgagtacacggttgtgcactccggt
tgcgcggtgaaggtcggcccaaccgtgccgatggacaggatatgcctgctgagctgtggt
gtatctgcagggcttggtgcagcctggaaggttgctgatatctcgaaggggtcgagtgtg
gttatatttggccttggaactgtagggctttctgttgctcaaggtgctaagctgcgcggg
gcttctataattatcggtgttgatactaatcctgaaaagcaagaaaaggggaaagctttt
ggtgtcacagattttattaatccagaagaattgaatgaacctgttcagcaggtggtgaag
cggctgaccaatggaggtgcagattactcttttgagtgcgtgggtgatacaggagtagtg
tcgactgcactgcaatcatgttctgatggttgggggctgactgtaactcttggtgtgcca
aaagcaaagccagaggtttctgctcattatgcactacttctgtctggaagaacattgaag
gggtctttgtttggaggatggagacctaaatctgatctacctttgttagtggacaagtat
gcaaacaaggaaatccaagtcgatgaccttgttacacatgatttgtcattcgattacatc
aacaaggcacttgaactgatgctagaaaacaagtgtttgcgatgtgtgattcacatgcct
cagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331130
Entry
4331130           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4331130
   00620 Pyruvate metabolism
    4331130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4331130
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4331130
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4331130
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     4331130
SSDB
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N TrkA_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4331130
NCBI-ProteinID: XP_015627169
UniProt: Q0DWH1
LinkDB
Position
2:34930288..34934044
AA seq 381 aa
MASSTQGQVITCKAAVAWEANRPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKD
PEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRA
ATGVGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPQAPLDKVCLLGCG
VSTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSKKFDVAKNF
GVTEFVNPKDHDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVA
ASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVTHSMNLTDI
NKAFDLLHEGGCLRCVLATDK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcttcctcgacccagggccaggtcatcacctgcaaagcggcggtggcatgggaggcc
aacaggccgatgacgatcgaggacgtgcaggtggcgccgccgcaggccggcgaggtccgt
gtcaagatcctcttcaccgcgctctgccacaccgaccactacacctggagcggcaaggat
cctgagggtctatttccttgcattcttggtcatgaagctgctggaattgttgaaagtgtt
ggggaaggagtaactgaggtgcagcctggggaccatgtcattccttgttaccaagcagaa
tgcagagaatgcaagttttgcaagagtggaaagaccaacctctgtggcaaagttcgtgct
gccacaggggtcggtgtcatgatgaatgatcgcaagagccgtttctcaataaatggaaaa
cccatttatcatttcatgggaacatctacattcagccagtatactgttgtgcacgatgtc
agtgtcgcaaagataaacccacaggcacctctagacaaagtttgcctgcttggctgcggt
gtttctactggcctcggagcagtatggaataccgcaaaggttgaagcaggttccatcgtt
gctatttttggacttggcacagttggacttgcagttgctgagggggcaaaatcagctggt
gcttctcggattattggcatcgacattgatagcaaaaagtttgatgtcgcaaagaacttt
ggggttacagaatttgtgaacccaaaggaccatgacaaaccaatccaacaggtcatagtt
gaccttacagacggtggtgtggactacagctttgaatgcattggaaatgtttctgttatg
aggtctgcattggagtgctgccacaagggctggggaacctctgtcatcgttggtgtagct
gcttctgggcaagaaatctctacacgaccattccagctcgtcactggccgtgtctggaag
ggaacagctttcggcggtttcaagagccgaagccaagttccatggctcgttgagaagtac
ttgaacaaggaaatcaaggtggacgagtacgttactcacagcatgaacctgactgacatc
aacaaggcgtttgacctgctgcatgaaggtggctgcctgcggtgtgttctggcaactgat
aaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331893
Entry
4331893           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase-like 7
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4331893
   00620 Pyruvate metabolism
    4331893
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4331893
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4331893
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4331893
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     4331893
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C Glu_dehyd_C PEP-CTERM AlaDh_PNT_C malic
Other DBs
NCBI-GeneID: 4331893
NCBI-ProteinID: XP_015630763
UniProt: Q10QP0 Q0DUF2
LinkDB
Position
3:complement(4667182..4680055)
AA seq 381 aa
MAGQIPQPIRCKAAVCRAAGEPLAVEEIVVDPPKAHEVRIKIVCTSLCHSDVTFWRMQDF
PGVFPRIFGHEAFGVVESVGEHVEGFAAGDPVVPTFLGQCTECVDCASERSNVCSTYRFA
VRPGMPRDGTARFRDRHGAPIHHFLGVSSFSEYTVVDANQVVRVDPAVPPATASLLSCGA
TTGVGAAWKLAKVEPGSSVAIFGLGAVGLAVAEGARICGASTIIGVDLNPEKHELGKKFG
VTHFINPQELGDKPVSQAIIEMTDGGADYCFECIGLASVMSDAFRSSREGWGKTIILGVE
MHGAPLSIPSLEILNGKCVMGSLFGGVKPKQDIPILADKYLNKELELDKFITHEVPLKDI
NTAFDLLLQGKSLRCTIWMDK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcgggtcagatcccccaacccatccgttgcaaagcggccgtgtgcagggccgctggc
gagccgctggccgtcgaggagatcgtcgtggacccgcccaaggcgcacgaggtccggatc
aagatcgtctgcacctcgctctgccacagcgacgtcacgttctggcgtatgcaggatttc
cccggcgttttcccgaggatttttgggcacgaagccttcggggtggtggagagcgtaggg
gagcatgtggaagggttcgccgccggcgacccggtggtgcccacgttcctgggccagtgc
accgagtgcgtggactgcgcctcggagcggagcaacgtgtgctccacgtaccggttcgcg
gtgcgccccgggatgccgcgcgacggcaccgcccgcttccgcgaccgccacggcgccccg
atccaccacttcctcggcgtctccagcttcagcgagtacaccgtcgtggacgccaaccag
gtcgtccgcgtcgaccccgccgtgccgcccgccacggcctccctcctcagctgcggcgcc
accaccggggtcggagcagcgtggaagctggctaaagtcgagccggggtcttcggttgct
atctttggcctcggcgccgtaggattagcggtagctgaaggggccaggatttgcggtgcg
tcaacgatcatcggcgtggatttgaaccctgagaaacatgaacttggaaagaagttcggt
gtgacgcacttcatcaatccacaagaacttggggacaaacctgtcagccaagcgatcatc
gagatgactgacggtggcgcggactactgcttcgagtgcatcgggctggcgtcggtgatg
agcgatgcatttcggagctcccgagagggatggggcaagacgatcattcttggcgtcgaa
atgcacggtgcccctttgtccattccttcgttggagatcctcaacggcaaatgcgtaatg
ggatcactcttcggaggggtgaaacccaagcaggacattcccatcctggccgacaagtat
ctgaacaaggagctggagttggacaagttcataactcacgaggttcccctgaaggacatc
aacacggcatttgaccttctgttgcaggggaagagtctcagatgcaccatttggatggac
aagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331894
Entry
4331894           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase-like 2
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4331894
   00620 Pyruvate metabolism
    4331894
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4331894
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4331894
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4331894
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     4331894
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C
Other DBs
NCBI-GeneID: 4331894
NCBI-ProteinID: XP_015630764
UniProt: B9F5L4 Q10QN9
LinkDB
Position
3:complement(4682349..4685314)
AA seq 379 aa
MEDQSLKPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLWHKVDP
AFPRILGHEAYGVVESVGENVEGLAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMG
PGMRRDGTTRFWDGEGKPLSDTVAVTSFSQYTVVDVNQVVKVDPAVPPKIACLLGCCGGT
GVGAAWRLAKVQPGSSVVVFGLGSVGLAVVQGAKMCGATKIIGVDLNPNKEEVGKEFGVT
DFVNPSQLGDKSVSEVINAMTDGGADYSFECIGISSVMTEAVRSTKSGRGKTIILGVEKD
SQPLCLPSFEFLFGKCVMGSLFGGAKPKTDIPILAEKCMNKELELEKLVTHEVGLTEINT
AFDLLLQGKSLRCIIWMDK
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggaagatcagagcctgaagcccatccgttgcaaagcggcggtctgtagagcggccagt
gagccactgatcgtcgaggagatcgtcgtcgatcctccgaaagcctacgagatccgcatc
aagatcatctgcacctccctgtgccacaccgatgtcaccctctggcacaaggtagaccct
gcctttccaagaatcttgggccacgaggcctacggggtggtggagagcgtgggggagaac
gtggaggggctcgcggcgggggacacggtggtgccgacgttcatggggcagtgcgactcg
tgcgccagctgcgcggcggagtggacgaaccagtgcaccgccgtgccgttcaccatgggc
cccgggatgcggcgcgacggcacaaccaggttctgggacggcgaagggaagccgctcagc
gacacggtggccgtcaccagcttcagccagtacaccgtcgtcgacgtcaaccaggtcgtc
aaggtcgaccccgccgtgccgcccaaaatcgcctgcctcctcggctgctgcggcggcacc
ggggtaggagcagcatggaggttggccaaagtgcaacccggttcgtcggtggttgtcttc
gggctgggatccgtcggattggcggtagtgcaaggggcaaaaatgtgtggagcaacgaag
attatcggtgttgatttgaatcctaacaaagaggaagttggaaaagagttcggtgtgact
gatttcgtcaatccatcccaactcggcgacaaatccgtcagtgaggtgatcaatgcgatg
acagacggtggcgctgactacagcttcgagtgcatcggtatctcgtcggtgatgactgag
gcagtcagaagcaccaaatcaggacggggcaagacgatcattctgggggtcgagaaggac
agccagccgttgtgcctgccgtccttcgagtttctgttcggcaagtgcgtcatgggatcg
ctcttcggtggggccaaacccaaaactgacatcccaatcctcgccgagaaatgcatgaac
aaggagctggaactggagaagctggtcactcatgaggtaggcctgacggagataaacaca
gccttcgatttgcttctgcagggaaagagcctgagatgcatcatatggatggacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343942
Entry
4343942           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase-like 2
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4343942
   00620 Pyruvate metabolism
    4343942
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4343942
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4343942
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4343942
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     4343942
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PEP-CTERM UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4343942
NCBI-ProteinID: XP_015646373
UniProt: B9FUA4 Q8LHA1
LinkDB
Position
7:complement(25696802..25704185)
AA seq 390 aa
MEQMNTAAAKSIRCRAAVSRVAGQPLEMEEVEVAPPRAHEVRIKILCTSICHTDITFWRM
EGNHPSIFGHEAVGVVESVGEHVQEVAVGDMVVPVFAAQCSECPDCLSDRSNLCSKLPNV
AGLMPRDRTTRFSSVSTGEPIRHFLSVSSFAEYTVVDITHIVKLDVGFPPAMACLLSCGI
STGVGAAWKVAAVEPGSSVAVFGLGAVGLAVAQGARMRGAKRIIGVDLNPDKFDVGKRLG
MTDFINPNDTGGKTVSEVIKEMTGGGGADYCFECIGSTSVMAEAFQSTRNGWGKTILLGV
SGNKAPISIPSHEILRGRSVIGSLFGGIKPKNDIPMLAQKYLDKELELEEFITHEMGFEE
INRAFELLTQGKSIRCIIWMDGAKVIDNGE
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggagcagatgaacactgctgctgcaaagtccatcaggtgcagagcggcggtgagcagg
gtggccgggcagccgctggagatggaggaggtggaggtggcgccgccgcgggcgcacgag
gtccggatcaagatcctctgcacatccatctgccacacggacatcaccttctggcgtatg
gaaggcaatcatccgtctatctttggccatgaagcagtcggtgtggtggagagcgtgggg
gagcacgtgcaggaggtggcggtgggtgacatggtggtgccggtgttcgccgcgcagtgc
agtgagtgccctgactgcctctccgaccgcagcaacctctgctccaaactgcccaacgtc
gccggcctcatgcctcgcgaccgcacgacgcgcttctcctccgtctccaccggcgagccc
atccgccacttcctctccgtctccagcttcgccgagtacaccgtcgttgacatcacccac
attgtcaagctcgatgttggattcccaccggcgatggcatgcctcctcagttgtggcatt
tccaccggtgttggtgcggcatggaaggtggcagcagtggagcccggctcgagtgtcgcc
gtgttcggcctgggtgccgttgggttagcggttgctcaaggggcgaggatgcgtggggct
aagaggattattggggtggacctgaacccggacaaattcgacgttggtaagaggctgggc
atgaccgacttcatcaacccgaacgataccggcgggaagaccgtgagcgaggtcatcaag
gagatgaccgggggcggcggcgccgactactgcttcgagtgcatcggctcgacttcggtc
atggcggaagccttccaaagcactcgaaatgggtgggggaagacgatcctgctcggcgtc
tccggcaacaaggcgccgatcagcatcccgtcgcacgagatcctccggggaagatcggtc
atcgggtcgctcttcggcggcatcaagcccaagaacgacatcccgatgctggctcagaag
tacctggacaaggagctggagctggaggagttcatcacgcacgagatggggttcgaggag
atcaacagggcgttcgagctgctcacgcaggggaagagcatccgctgcatcatctggatg
gacggcgccaaggtgatcgacaacggcgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348152
Entry
4348152           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase-like 4
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348152
   00620 Pyruvate metabolism
    4348152
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4348152
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4348152
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4348152
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4348152
NCBI-ProteinID: XP_015612744
UniProt: Q10A46 Q0IYU8
LinkDB
Position
10:complement(3793834..3803841)
AA seq 403 aa
MDATAIGNGALHSNGAGADTKGKPIKCKAAVAHGPGEALVMEEVEVAPPARMEVRLKVLF
TSICHTDLSAWKGENELQRKFPRILGHEAAGVVESVGEGVEDLAPGDHVVPIFTGECGAC
TYCESSKSNLCKTYRVNPFKSTMVTDGGTRFTMIDRSSGARNPVYHFLNTSTFAEYTVID
SACAVKINPKAPLEKMSLLSCGVSTGVGAAWNTANVSKGSTVAIFGLGAIGLAVAEGARL
RGASRIIGVDINPEKFSKGKEMGITDFINSKASGKPVHEVIMEMTDGGVDYSFECTGITD
VLREAFVSTHDGWGLTVVLGIHATPRMLPLHPMELFDGRRITGCVFGDFKGKSQLPEIVE
KCMQGEININFDGFITQELPFADINKAFQLLEEGKSLRCLLHV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggatgccactgccatcggcaacggcgccctgcactccaatggcgccggcgccgacacc
aaagggaagccgatcaaatgcaaagcggcggtggcgcacggccccggcgaggcgctggtg
atggaggaggtggaggtggcgccgccggcgaggatggaggtgcgcctcaaggtgctcttc
acctctatctgccataccgacctcagcgcctggaaaggagagaacgagcttcagcgaaag
tttcctcgcatattgggtcatgaggcagcaggggtggtggagagcgtgggagagggtgtg
gaggatcttgcccctggagatcatgttgtccccatcttcaccggcgagtgtggtgcgtgc
acctactgcgagtccagcaagagcaacctatgcaaaacctaccgtgtcaacccattcaag
agcaccatggtcaccgatggtggcacgaggttcaccatgatcgaccgctcctccggtgca
cgcaacccggtctaccattttctcaacacttccacctttgctgagtacactgtgattgac
tccgcttgcgctgtcaagatcaaccctaaggctcccttggagaagatgagtctcctcagc
tgtggggtctccacaggagtgggagctgcatggaacactgcaaacgtctccaaggggtcc
acagtggcaatatttgggcttggtgccattggtcttgcggttgccgaaggtgccagattg
agaggagcatctcgaatcatcggagttgacataaaccctgaaaaattctccaaaggcaaa
gagatgggcatcactgacttcatcaactcgaaggcatctggcaagcctgtccacgaggtt
atcatggagatgacagatggcggtgtcgactacagcttcgagtgcaccggcatcaccgat
gttctacgggaggccttcgtttccacacatgatggatggggcctgaccgttgtgctgggg
atccatgcaacgcccaggatgctgccgctgcatccaatggagttatttgacggccgtcgg
atcactggctgcgtttttggtgacttcaagggaaagtcccagctgcctgaaatcgtggag
aagtgcatgcagggtgagattaacataaattttgatgggttcataacacaagagttgccc
ttcgccgacatcaacaaagctttccagctgctggaagaggggaagtcactcagatgtctg
ctccatgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350053
Entry
4350053           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase 1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350053
   00620 Pyruvate metabolism
    4350053
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4350053
   00592 alpha-Linolenic acid metabolism
    4350053
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4350053
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4350053
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4350053
NCBI-ProteinID: XP_015616853
UniProt: Q2R8Z5 B6F2C1
LinkDB
Position
11:complement(5712792..5716283)
AA seq 379 aa
MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINT
DRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGIS
TGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGIDLNANRFEEARKFGC
TEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHK
DAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINT
AFDLMHKGEGIRCIIRMEN
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcgaccgcagggaaggtgatcaagtgcaaagcggcggtggcatgggaggccgcgaag
ccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaag
atcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaagggacagact
cccgtgttccctcggatcttcggccatgaagctggaggtattgtggagagtgttggagag
ggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaag
gagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacact
gacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatt
taccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgtt
gcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttct
actggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgata
tttggtctaggagctgtaggccttgctgccgcagaaggtgcaaggattgcaggagcgtca
aggatcattggcattgacctgaacgccaacagatttgaagaagctaggaaatttggttgc
actgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtacttgctgagatg
accaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaa
gcatttgaatgtgttcatgatggctggggtgttgctgttttggtcggcgtgccacacaag
gacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaacc
ttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaag
aaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacg
gcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350054
Entry
4350054           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase 2
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350054
   00620 Pyruvate metabolism
    4350054
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4350054
   00592 alpha-Linolenic acid metabolism
    4350054
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4350054
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4350054
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N
Other DBs
NCBI-GeneID: 4350054
NCBI-ProteinID: XP_015616854
UniProt: Q0ITW7 A0A0R7VIL1
LinkDB
Position
11:complement(5745026..5748190)
AA seq 379 aa
MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQT
PVFPRILGHEAGGIVESVGEGVTELAPGDHVLPVFTGECKECDHCKSEESNMCDLLRINV
DRGVMIGDGKSRFTIKGKPIFHFVGTSTFSEYTVIHVGCLAKINPEAPLDKVCILSCGFS
TGFGATVNVAKPKKGQTVAIFGLGAVGLAAMEGARLSGASRIIGVDLNPAKFEQAKKFGC
TDFVNPKDHSKPVHEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGWGVAVLVGVPTK
DDVFKTHPMNFLNEKTLKGTFFGNYKPRTDLPNVVELYMKKELELEKFITHSVPFSEINT
AFDLMLKGESLRCVMRMDE
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcgacagccgggaaggtgatcaagtgcaaagcggcggtggcatgggaggccgggaag
ccgctgtcgatcgaggaggtggaggttgcgccgccgcaggccatggaggtccgcgtcaag
atcctctacaccgccctctgccacaccgacgtctacttctgggaggccaaggggcaaaca
cctgttttccctaggatcttgggccatgaagctggaggcattgtggagagtgtgggagag
ggtgtgaccgaactcgcgccgggcgaccatgtcctcccggtgttcaccggcgagtgcaag
gagtgtgatcactgcaaatcggaggagagcaacatgtgtgacctcctcaggatcaacgtc
gaccgcggcgtcatgatcggcgacggcaagtcccgattcaccatcaaggggaagcccatc
ttccactttgttggcacatccaccttcagcgagtacaccgtcatccatgtcggctgcctc
gcgaagatcaacccggaggcgcctctcgacaaggtctgcattctcagctgcggtttctct
accggttttggtgcaacagtgaatgtcgcgaaaccgaaaaagggccagaccgtggctatt
ttcggtcttggagctgttggtcttgctgctatggaaggtgccaggctgtctggagcatcg
aggatcattggtgtggacctgaaccctgcgaaattcgaacaagctaagaagtttggctgc
actgacttcgtaaaccccaaggaccacagcaagccagtgcacgaggtgctgattgagatg
accaacggtggactcgacagggccgttgaatgcacgggcaacatcaacgccatgatatcc
tgcttcgaatgtgtccatgatggatggggcgttgcggtgctggtcggcgtgccgaccaag
gatgatgtgttcaagacccacccgatgaacttcctcaacgagaagacgctcaaggggacg
ttcttcggtaactacaagccgcgcaccgacctgcccaacgtcgtcgagctgtacatgaag
aaggagctggagctggagaagttcatcacgcacagcgtgccgttctcggagatcaacacg
gcgttcgatctcatgctcaagggggagagtctccgctgcgtcatgaggatggatgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350055
Entry
4350055           CDS       T01015                                 
Name
(RefSeq) alcohol dehydrogenase 2
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350055
   00620 Pyruvate metabolism
    4350055
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4350055
   00592 alpha-Linolenic acid metabolism
    4350055
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4350055
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4350055
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4350055
NCBI-ProteinID: XP_015616852
UniProt: Q2R8Z1
LinkDB
Position
11:complement(5755669..5760114)
AA seq 380 aa
MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRLKILYTALCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEGVTELSPGDHVLPVFTGECGDCRHCLSEESNLCDLLRINT
DRGAMIGDGQTRFTARGGQPVYHFLGTSTFSEYTVVHVGCVAKIHPAAPLDKVCVLSCGI
STGFGATVNVAKPPKGCTVAIFGLGAVGLAAMEGARISGASRIIGVDLNPAKFELAKKFG
CTDFVNPKDYDKPVQQVIIEMTNGGVDRSVECTGNAAAMISAFECVHDGWGVAVLVGVAG
KDAAFKTHPTNFLNERTLRGTFFGNYKPRTDLPGVVEMYMNKELELEKFITHSVPFSEIN
TAFDLMLSGESLRCIIRMED
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcaactgcagggaaagtgatcaagtgcaaagcggcggtggcttgggaggccgggaag
ccgctgtcaatcgaggaggtggaggttgcgccgccgcaagccatggaggttcgcctcaag
atcctctacacggcgctctgccacaccgacgtctacttctgggaagccaaggggcaaact
ccggtgttccctcggatcttcggccacgaagctggagggattgtggagagtgtgggcgag
ggggtgacggagctttcccccggcgaccacgtgctgccggtgttcaccggcgagtgcggc
gactgccggcactgcctgtcggaggagagcaacctgtgcgacctcctccgcatcaacacc
gaccgtggcgccatgatcggcgacggccagaccaggttcaccgccaggggagggcagccg
gtgtaccacttcctcggcacctccacgttcagcgagtacaccgtcgtccatgtcggctgc
gtcgccaagatccacccagcggcgccgctcgacaaggtctgcgtcctcagctgtggcatc
tccaccggatttggcgcgactgtgaacgtcgccaagccaccgaaggggtgcacagtagcc
atattcggcctgggtgcagttggtcttgctgccatggaaggtgcaaggatctctggtgct
tcacggattattggcgtcgatttgaacccggccaaattcgaactagctaagaagtttggg
tgcacagactttgtgaacccaaaagattacgacaagcccgttcagcaggtgatcatcgag
atgaccaacggcggcgtggaccgcagcgtggagtgcaccggcaacgccgccgccatgatc
tccgccttcgagtgcgtccacgacgggtggggagtggccgtgctggtgggcgtcgccggc
aaggacgcggcgttcaagacgcacccgaccaacttcctcaacgagaggacgctcaggggc
acgttcttcggcaactacaagcctcgcaccgacctgcccggcgtcgtcgagatgtacatg
aacaaggagctggagctggagaagttcatcacgcacagcgtgcccttctccgagatcaac
acggcgttcgacctgatgctcagtggggagagcctccgctgcatcatcaggatggaggac
tag

DBGET integrated database retrieval system