KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330104
Entry
4330104           CDS       T01015                                 
Name
(RefSeq) sphingolipid delta(4)-desaturase DES1-like
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4330104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4330104
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     4330104
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     4330104
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  Sphingolipid
   4330104
SSDB
Motif
Pfam: FA_desaturase Lipid_DES
Other DBs
NCBI-GeneID: 4330104
NCBI-ProteinID: XP_015623789
UniProt: Q6H5U3
LinkDB
Position
2:25660296..25664349
AA seq 328 aa
MGAAAGDGREEEGVMATDFFWSYTDEPHATRRREILAKHPQIKELFGPDPLAFLKIAAVV
SLQLWTATLLRDASWVKILTVAYFFGSFLNHNLFLAIHELSHNLAFTTPSYNRWLGIFAN
LPIGVPMSITFQKYHLEHHRFQGVDGIDMDIPSQAEAHAVKNTLSKSVWVVFQLFFYALR
PLFLKPKPPGLWEFTNLIIQIALDASMVYFFGWKSLAYLILSTFVGGGMHPMAGHFISEH
YVFNPDQETYSYYGPLNLMTWHVGYHNEHHDFPRIPGTRLYKVREIAPEYYNNLKSYKSW
SQVIYMYIMDQTVGPFSRMKRKAPKKDS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcgccgcggcgggggatggacgggaggaggaaggggtgatggcgacggacttcttc
tggtcgtacacggacgagccgcacgcgacgcggcgcagggagatcctggccaagcatccc
cagatcaaggagctcttcggcccggacccgctcgcctttctcaagattgctgcagttgta
tcacttcagctatggactgccacattactccgagatgctagttgggtgaagatactgaca
gttgcatatttttttggatcctttttgaaccacaatctcttccttgcaatccacgagctc
agtcacaatcttgcgttcacaactccgagctacaatcgctggctaggtatatttgctaac
cttcctatcggtgttcccatgtccattacattccagaagtaccacttggagcaccaccgt
ttccaaggtgttgatggaattgatatggatatccccagccaagcagaggcgcatgctgtt
aagaatactctaagcaaatctgtatgggttgtcttccagctgttcttttatgcccttaga
ccgctgttcctcaagccaaaacctcctggcctgtgggaattcaccaatttgattatccag
attgcgcttgatgccagcatggtgtacttctttggatggaaatcactagcttatctgata
ctctcaacatttgttggtggtggcatgcatcctatggctggacatttcatctcagagcac
tacgtattcaatccagaccaggagacttattcgtattatggacctttgaatctgatgaca
tggcatgttggataccacaatgagcaccatgatttcccaagaattccaggaacaagactg
tacaaggtaagggaaatcgcaccagagtattacaacaatctgaaatcatacaaatcttgg
agccaggtgatatacatgtacatcatggaccaaactgttggtcctttcagccggatgaag
agaaaggcgccgaaaaaagattcatag

DBGET integrated database retrieval system