KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330120
Entry
4330120           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 8
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4330120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4330120
   03036 Chromosome and associated proteins [BR:osa03036]
    4330120
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4330120
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4330120
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4330120
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    4330120
SSDB
Motif
Pfam: DEAD Helicase_C TFIIA CMS1
Other DBs
NCBI-GeneID: 4330120
NCBI-ProteinID: XP_015627069
UniProt: Q6H7S2
LinkDB
Position
2:25767214..25774460
AA seq 508 aa
MDPRARYPPGIGNGRGGNPNYYNRGPPLQQQHNHHQQQQTSAPHHQQYVQRQPQQHHHHN
HHQQHQQQQQQWLRRNQIAREAAGTDRNSEPKAVAQSPAVDGIDSSSQDWKAQLKLPPQD
TRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKN
GTGKTAAFCIPALEKIDQEKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGT
SLKDDIIRLYQPVHLLVGTPGRILDLTKKGICILKDCSMLIMDEADKLLSPEFQPSVEQL
IRYLPASRQILMFSATFPVTVKEFKDKYLPKPYVINLMDELTLKGITQFYAFVEERQKVH
CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNG
ACRNLVCTDLFTRGIDIQAVNVVINFDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDR
FNLYRIEQELGTEIKPIPPQIDQAIYCQ
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggatccgcgcgccaggtaccctcccggcatcggcaacggccgcggcgggaaccccaac
tactacaaccgcggcccgccgctgcagcagcagcacaaccaccaccagcagcagcagacg
tcggcgccgcaccaccagcagtacgtgcagcgccagccgcagcagcatcaccaccacaac
caccaccagcagcatcagcaacagcagcagcagtggctgcggcggaatcagatcgcccgc
gaggccgcgggaaccgacaggaatagcgagccgaaggctgtggcgcaatccccagccgtc
gacggcatcgattcgagttcacaagactggaaggcccaattgaagcttccacctcaagat
acacgatacaggacagaggatgttacagccaccaaaggaaatgagtttgaagactatttt
ctcaagcgtgaacttctgatgggaatatatgagaaaggatttgaaagaccctctccgatc
caagaagaaagcattcctattgcattaactggtagtgatattctagccagagcaaaaaat
ggaactggcaagactgctgcattttgtatccctgcactagaaaagattgatcaagagaaa
aacgctattcaagttgttatattggttcccacaagggagctggctttgcaaacgtcacaa
gtttgtaaagagcttgggaaacatctgaagatccaggtcatggtcaccactggaggaacc
agcctgaaagatgatatcattcgtctctatcaacctgtccatttacttgttggaacgcct
gggcgtattttggaccttacaaagaaaggtatctgcattttgaaggactgctctatgctt
atcatggatgaggcagacaagcttctctctcctgagttccagccttccgtggaacagctg
attcgttaccttccagcgagccggcaaattttgatgttctcggcaacgttccctgtgact
gtgaaggagttcaaggacaaatacctgcctaaaccttatgttattaaccttatggatgaa
cttacactgaagggaattacacagttttatgcttttgtagaagaaaggcagaaagttcat
tgccttaacactctcttttccaagcttcaaatcaaccaatcaataatcttctgcaactct
gtaaatcgtgttgagcttctggcaaagaagatcacggagcttggttactcttgcttctac
atccatgcaaagatgctgcaagaccatcgtaatagagttttccatgatttccgtaatggg
gcatgcaggaacctggtttgtacagatcttttcacaaggggaattgacattcaagctgtt
aatgttgttatcaattttgatttccccaaaaccgctgaaacatacctccacagggttggt
agatctgggagatttggccatcttggcctggctgtgaatttgatcacctatgaggatcgg
tttaacttgtataggattgagcaagagcttgggactgagataaaaccaattcctcctcag
attgaccaagctatatattgccaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336501
Entry
4336501           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 6
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336501
   03036 Chromosome and associated proteins [BR:osa03036]
    4336501
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4336501
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4336501
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4336501
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    4336501
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 TFIIA
Other DBs
NCBI-GeneID: 4336501
NCBI-ProteinID: XP_015636229
UniProt: Q7XMK8
LinkDB
Position
4:26644027..26650204
AA seq 498 aa
MDPRARYPPGIGNGRGGNPNYYGRGPPPSQHQQHQHQHQQPPHPHHHQYVQRQPQPQQTP
HNSQHQQWLRRNQIAAEAAGASEQKAPPVADGIDSSSQDWKAQLKLPPQDTRYRTEDVTA
TKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCI
PALEKIDQDKNAIQVVILVPTRELALQTSQVCKELGKHLKIQVMVTTGGTSLKDDIVRLY
QPVHLLVGTPGRILDLTKKGVCVLKNCSMLVMDEADKLLSPEFQPSIQELIRYLPSNRQI
LMFSATFPVTVKEFKDKYLPKPYVINLMDELTLKGITQFYAFVEERQKVHCLNTLFSKLQ
INQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDL
FTRGIDIQAVNVVINFDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQEL
GTEIKPIPPQIDRAIYCQ
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggatccgcgcgcgaggtaccctcccggcatcggcaacggccggggcgggaaccctaac
tactacggccgtggcccaccgccatcgcagcatcagcagcaccagcaccagcaccagcag
ccgccgcacccgcaccaccaccagtacgtgcagcggcagccgcagccgcagcaaacgccg
cacaacagccagcatcagcagtggcttcggcggaaccagatcgccgccgaggccgcgggc
gccagcgagcagaaggcgccgcctgtcgcggacggcatagattcgagttcacaagactgg
aaggcccaactgaagctcccaccgcaagatacacgctacaggacagaggatgttactgct
accaagggaaatgaatttgaagactattttctgaagcgagaactccttatggggatatat
gagaaaggatttgaaagaccttctcctatacaagaagaaagtattcctattgcattaact
ggcagtgatattcttgcaagagcaaaaaatggaactggcaagactgctgcattttgtata
cccgcgctggaaaagattgatcaagacaaaaatgctattcaagttgttatattggttccc
acaagggaattggctctacaaacatcacaagtttgcaaggagcttgggaaacatttgaag
attcaagtgatggtcactactggaggaaccagcctaaaggatgatattgtccgtctttat
caacctgttcatttacttgttggaactcctggtcgcattttagaccttacaaagaaaggt
gtctgcgtcctgaagaactgttcaatgcttgttatggatgaggcagacaagcttctttct
cctgagttccaaccgtctattcaggaattgattcggtatcttccatcgaatcggcaaatt
ttgatgttctctgcaacattccctgtgactgtcaaggagttcaaggacaaatatctccct
aaaccctatgtcattaaccttatggatgaacttacattgaagggaattacacagttttat
gcttttgttgaagagaggcagaaagtccactgtcttaatactcttttttccaagctgcaa
attaatcaatcgataatattctgtaactcggtaaatcgtgttgaactattggcaaagaag
atcacagagcttggttattcttgcttctatatccatgctaaaatgttgcaagaccatcgg
aacagggttttccatgattttcgcaatggtgcatgcaggaacttggtttgtacagatctt
tttacaaggggaatagatatccaagctgttaatgttgttatcaattttgatttccccaag
agcgcagaaacatatctccatagggttggtagatctggcagattcggccaccttggtttg
gctgtgaatttgatcacctatgaggaccgttttaacttgtatcgcattgaacaagagctt
ggaaccgagataaaaccaataccacctcagatagaccgagcaatatattgccaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349053
Entry
4349053           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 12
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4349053
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349053
   03036 Chromosome and associated proteins [BR:osa03036]
    4349053
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4349053
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4349053
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4349053
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    4349053
SSDB
Motif
Pfam: DEAD Helicase_C Sirohm_synth_M EPL1 TFIIA
Other DBs
NCBI-GeneID: 4349053
NCBI-ProteinID: XP_015614831
UniProt: Q109G2
LinkDB
Position
10:complement(19236426..19241929)
AA seq 521 aa
MHHPRARYPPGYTSGGGGGGGGGGGGGRGNGGGGFGGGGGGGGGNHGYYGRGPQPQPQQQ
HYHHQAQQLHQHQQQQQHAQRNSSSQQQQWLRRDQATAAAASGEVAARTAAQLEAVDSSS
EDWKAQLNLPAPDTRYRTEDVTATKGNEFEDYFLKRELLMGIYEKGFERPSPIQEESIPI
ALTGSDILARAKNGTGKTAAFCIPALEKIDPEKNAIQVVILVPTRELALQTSQVCKELGK
YLNIQVMVSTGGTSLKDDIMRLYQPVHLLVGTPGRILDLTRKGICVLKDCSMLVMDEADK
LLAPEFQPSIEQLIHFLPANRQLLMFSATFPVTVKDFKEKYLPRPYVINLMDELTLKGIT
QYYAFVEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQ
DHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTSETYLHRVGRSGRFGH
LGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcaccaccccagggcgcgctacccgcccggctacacctccggcggcggcggcggaggc
ggaggcggaggaggaggcggccgtggtaatggcggcggcggatttggaggaggtggcggc
ggcggcggcgggaaccacggctactacggccggggtccgcagccgcagccgcagcagcag
cactaccaccaccaggcgcagcagctgcatcagcatcagcagcagcagcagcacgcgcag
aggaacagctcctcgcagcagcagcagtggctgcggcgggaccaggccacggcggcggct
gcgtccggggaggtcgcggcgaggacggcggcgcagctggaagccgtcgactcgagctct
gaagattggaaggcacaattgaatttgccagctccagatacacgttataggacagaggat
gtcactgcaacgaaaggcaacgagtttgaggattactttttgaaacgtgaactactaatg
ggaatatatgagaaaggattcgaaaggccatcacctattcaggaagaaagcattccaata
gctctgactggtagcgatattcttgcaagagctaaaaacggcactggcaagactgccgca
ttttgcattcccgcacttgaaaaaattgatccagagaaaaatgccatacaagttgttata
ttggtaccaacacgggaactagctctgcagacctcacaagtttgtaaagagcttgggaag
tatctgaatattcaagttatggttagtactggtggaaccagcttaaaggatgacattatg
cgtttgtatcaacctgttcatttacttgttgggacacctggtcggatactagatctaact
aggaagggcatctgtgtgctgaaggattgttcaatgctcgtaatggatgaggcagacaaa
ctgttagctccagagtttcagccttccatagagcaactcatccatttccttccagctaat
cgtcaactattgatgttttcagcaacctttccagtaaccgttaaggatttcaaagagaaa
tacctacctaggccttatgttattaatctcatggatgaactaacactaaagggaattaca
caatactatgctttcgtggaagaaagacagaaagttcactgtctgaatacacttttctcg
aagcttcaaataaaccagtccattatattctgtaactctgttaacagagttgagctactg
gctaagaaaatcaccgagcttggctattcatgcttctacattcatgcaaaaatgttgcaa
gaccatcgaaaccgagtgtttcatgattttcgcaatggtgcttgcagaaaccttgtgtgc
acagatctgtttacaagaggaattgacatccaagctgtgaatgttgtcattaattttgac
ttccctaagacttctgaaacatacttgcatagggttggtcgttcagggagatttggacac
cttggtttggcggtgaacttaatcacttatgaggaccgtttcaacttgtatcggattgag
caagaacttgggacagaaataaaaacgatacccccacaaatcgatctggcagtgtattgt
caatga

DBGET integrated database retrieval system