KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330146
Entry
4330146           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 3 member F1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330146
   00053 Ascorbate and aldarate metabolism
    4330146
   00620 Pyruvate metabolism
    4330146
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4330146
   00561 Glycerolipid metabolism
    4330146
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4330146
   00310 Lysine degradation
    4330146
   00330 Arginine and proline metabolism
    4330146
   00340 Histidine metabolism
    4330146
   00380 Tryptophan metabolism
    4330146
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4330146
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4330146
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4330146
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4330146
SSDB
Motif
Pfam: Aldedh Oxidored_q5_N
Other DBs
NCBI-GeneID: 4330146
NCBI-ProteinID: XP_015623875
UniProt: Q6H627 Q6H6X8
LinkDB
Position
2:complement(26034320..26041417)
AA seq 487 aa
MEEKPQHGSLGGLVAGVREEYESGRTKELEWRKAQLGGLIRMITEEEDAIFDALHDDLGK
HRVESFRDEVGVLAKSVRNTLQNLKKWASPEKVDVPLISFPCNARVVPEPIGVVLIFSCW
NLPIGLALEPLSGAIAAGNAVVLKPSEFAPSTAAFLAANIPKYLDANAVKVVQGGAEVGE
ELMEHRWDKVLFTGNARVGRIIMTKAAKHLTPVALELGSKCPCIVDCLDSKRECQVAVNR
IIGAKWSTCAGQACVAIDYILVEEQFAPFLIELLKSTLKRFFTEPEYMARILNEKHFHRL
TNLLEDDQVKSSIVHGGNADPKTLWIEPTIVLNPPFDSDIMMEEIFGPLLPIITVKKTED
CIAFLKSKPKPLAIYAFTNNEKLKQRIVAETSSGSVLFNDAIVQYGLDSVPFGGIGESGF
GQYHGKYTFELFSHRKAVVRRSLLVEFMFRYPPWDEYKMGMLRRVFRFDYVSLVLALLAF
WLLGIRR
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggaggagaagccgcagcacggcagcttgggcggcttggtggccggcgtgagggaggag
tacgagagcgggaggaccaaggagctggagtggaggaaggcgcagctcgggggcctcatc
aggatgatcacggaggaggaggacgccatcttcgacgcgctccacgacgacctcggcaag
caccgcgtcgagtccttccgagacgaggttggggttcttgccaagtccgtcaggaacacg
ctgcaaaacctcaagaaatgggcttcgcccgagaaggttgatgtgccgcttatttcattt
ccatgcaacgctcgggtcgtgccggaaccaatcggggttgtgctcattttctcatgctgg
aatctcccaataggcttagctctagagccactctccggggccatagcggccggcaacgcc
gttgttctgaagccctccgagtttgcaccgtcaaccgccgcgttcctcgccgccaacata
ccgaagtatctggacgccaatgccgtgaaggtcgtacagggcggggcggaggtaggagag
gagctcatggagcacagatgggacaaggtccttttcaccgggaatgctcgtgtagggcgc
atcattatgacgaaagcagcgaaacacctgacgccggtcgcgcttgagcttggctcgaaa
tgcccgtgcatcgttgactgccttgacagtaagagggagtgtcaggtcgccgtgaatcgg
ataatcggagcgaaatggtctacttgtgcaggacaagcttgcgttgccatcgattacata
cttgtcgaggaacagtttgcaccattcctgattgaactgcttaaatctacactcaagagg
ttctttaccgaaccagagtacatggcgcgcatcctgaacgagaagcatttccataggttg
acaaaccttctagaggatgatcaagtgaaatcctccattgtgcacggcggcaacgctgac
cccaagacactgtggatcgagcccaccatcgtgctgaatccaccgttcgactccgacatc
atgatggaggagatattcgggccactgctcccaatcataacggtaaagaaaacagaggat
tgcatcgcgttcttgaaatcgaagcccaaaccgcttgccatctacgccttcaccaacaac
gagaagttgaaacagcggatcgtcgcagaaacgtcctccgggagcgtcttgttcaacgac
gcgattgtgcagtacgggctggacagcgtcccgttcggcgggatcggggagagcgggttc
gggcagtaccacggcaagtacacgttcgagctgttcagccacaggaaggcggtggtcagg
aggagcctcctggtcgagttcatgttcagatacccgccttgggacgagtacaagatgggg
atgttgcgccgcgtcttcaggttcgactacgtctcgctcgtgcttgcgctgctcgccttt
tggctgctcggcataaggcgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330149
Entry
4330149           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 3 member F1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330149
   00053 Ascorbate and aldarate metabolism
    4330149
   00620 Pyruvate metabolism
    4330149
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4330149
   00561 Glycerolipid metabolism
    4330149
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4330149
   00310 Lysine degradation
    4330149
   00330 Arginine and proline metabolism
    4330149
   00340 Histidine metabolism
    4330149
   00380 Tryptophan metabolism
    4330149
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4330149
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4330149
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4330149
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4330149
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4330149
NCBI-ProteinID: XP_015623591
UniProt: B9F1D3 Q0DZ46
LinkDB
Position
2:26079786..26085545
AA seq 491 aa
MAPAMVAAMGEKPKPAVVLGGMVSGLREVYESGRTKDLEWRQSQLKALIRLLTDKEEEIF
AVLHDDLGKHRGESFRDELGILVKSIKYTLQNLKKWAASERAESPLVAFPATAMVVPEPL
GVVLVFSCWNLPLGLALEPLSGAIAAGNAVVLKPSELAPSTAAFLAANIPRYLDSRAVKV
VLGGPNVGEELMEHRWDKVLFTGSARIGRIIMAKAVKHLTPVALELGSKCPCIVDWLDSK
RDRQIAVNRIIGAKWSTCAGQACIAIDHVIVEERFAPILIELLKSTLKRFMAKPGGMARI
LNAKHFERLSGYLEDNRVAASVVHGGYMDPKKLNIEPTLLLNPPADSDVMTEEVFGPILP
IITVKKIEDCIAYLKSKPKPIAMYAFTNNERLKRRIVEETSSGSVTFNDAVVQYALESVP
FGGVGHSGFGQYHGKYSFELFSHKKAVFKRSFLIEFMFRYPPWDERKIGTLRHVFSYNYF
LLFFNLLGFRR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggccccggcaatggtagccgccatgggagagaagccgaagcccgcagtcgtgttgggc
ggcatggtgagcgggctgagggaggtgtacgagagcgggaggaccaaggacctggagtgg
aggcagtcgcagctcaaggcgctcatcaggctcctcaccgacaaggaggaggagatcttc
gccgtcctccacgacgacctcggcaagcaccgcggcgagtcgttccgagacgagcttggg
attcttgtcaagtcgatcaagtacacgctgcaaaacctcaagaaatgggcggcttcggag
agggcggaatcgccgttggttgcattccctgcgaccgcgatggtggtgccggagccgctc
ggtgtcgtgctcgttttctcctgctggaatctgccactaggcttagcgttggagccactc
tccggcgccatagcggccggcaacgccgttgttctgaagccctccgagctcgcgccgtcc
accgccgcgttcctcgccgccaacatcccgaggtatctggacagcagggcagtgaaggtc
gtcctgggaggccccaatgttggagaggaactcatggagcacagatgggacaaggttctt
ttcaccgggagtgccagaataggacgcattatcatggctaaagcagtcaaacacttgacc
ccggttgcacttgaactgggttcgaaatgcccatgcatcgttgattggctggacagtaag
agggataggcagattgcggtgaaccgcataatcggagcgaaatggtcgacttgtgctggt
caggcttgcatcgccatcgatcacgtaatcgtcgaggagagatttgcaccgattctgatt
gagctactgaaatcaactcttaagaggttcatggccaaaccgggtggcatggcccgtatc
ctgaacgcaaaacattttgagaggttgagtggctatctggaggataatagggtggcagct
tctgtagtgcacggtggttacatggaccccaagaaactgaatattgagccaaccttactg
ctaaatcctcctgctgattctgatgtcatgaccgaggaggtatttggcccgattctccca
atcatcacggtaaagaagatcgaggattgcatcgcgtatttaaagtccaagccgaaaccg
attgcgatgtacgccttcaccaacaacgagaggctgaaacgccggatcgtagaggaaacg
tcgtccgggagtgtcacattcaacgacgcagttgtgcagtacgctcttgaaagcgtccct
ttcggcggagttggccatagcggattcggacagtaccacggcaagtactcattcgagctg
ttcagccacaagaaggcggtgttcaagagaagctttctgatcgagttcatgttcagatac
ccaccatgggatgagagaaagatcgggacgctgaggcacgtcttcagctataactacttc
ttgctgttcttcaacctgctcggctttaggagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330612
Entry
4330612           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330612
   00053 Ascorbate and aldarate metabolism
    4330612
   00620 Pyruvate metabolism
    4330612
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4330612
   00561 Glycerolipid metabolism
    4330612
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4330612
   00310 Lysine degradation
    4330612
   00330 Arginine and proline metabolism
    4330612
   00340 Histidine metabolism
    4330612
   00380 Tryptophan metabolism
    4330612
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4330612
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4330612
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4330612
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4330612
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4330612
NCBI-ProteinID: XP_015625448
UniProt: B9F2I7 Q9LRI6
LinkDB
Position
2:complement(30393293..30396790)
AA seq 553 aa
MAARRAASSLLSRGLIARPSAASSTGDSAILGAGSARGFLPGSLHRFSAAPAAAATAAAT
EEPIQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAAR
RAFDEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARY
MRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNA
VVLKTAEQTPLSALFVASLLHEAGLPDGVLNVVSGFGPTAGAALSSHMGVDKLAFTGSTG
TGKIVLELAARSNLKPVTLELGGKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRT
FVHERVYDEFVEKARARALQRVVGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLV
AGGDRAGSRGFYIQPTVFADVEDEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLA
AGVFTQRLDAANTLARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQT
KAVVTPIKDAAWL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcggcaaggagggctgcttcctccctcctctctcgcggcctcatcgcgaggccttct
gctgcctcctccactggcgactccgctatccttggagcaggctcagcacggggcttcttg
cctggatcacttcacagattcagcgctgcaccggccgccgctgccaccgccgcagccact
gaggagccgatccagccgccggtggacgtgaagtacaccaagctcctcatcaatggcaac
ttcgtcgatgcagcatctgggaagacgttcgcgacggtggatccccgcaccggcgatgtc
attgcccgcgtggccgagggcgacgcggaggacgtcaaccgcgccgtcgccgccgcccgc
cgggccttcgacgagggcccgtggccgcggatgaccgcctacgagcggtgcagggtgttg
ctgcggttcgcggacctgatcgagcagcacgccgatgagatcgcggcgctggagacgtgg
gacggcgggaagacgctggagcagacgacggggacggaggtgccgatggtggcgcggtac
atgcggtactacggcgggtgggcggacaagatccacggcctcgtcgtgccggcggatggg
ccacaccacgtgcaggtgctacacgagcccatcggcgtggccgggcagatcatcccctgg
aacttcccgctgctcatgttcgcctggaaggtcggcccggcgctcgcctgcggcaacgcc
gtcgtgctcaagaccgccgagcagacgccgctctccgcgctcttcgtcgccagcctgctc
cacgaggctggcctccccgacggcgttctcaacgtcgtctccggctttggtccgaccgcc
ggcgccgctctctccagccacatgggtgtcgacaagcttgcattcaccggttcgacgggc
acgggcaagatcgtgcttgagctggccgcaaggagcaaccttaagccggtgacgctggag
ctcggaggcaaatcacctttcatcgtcatggatgacgccgatgtcgaccaggccgtcgag
cttgcgcaccgcgcgctcttcttcaaccaggggcaatgctgctgcgcggggtcacgcacg
ttcgtgcacgagcgcgtctacgacgagttcgtggagaaggccagggctcgcgctctgcag
cgtgtggtcggcgacccattcaggacaggcgtcgagcaggggcctcagatcgacggcgag
caattcaagaagatcttgcagtacgtcaagtcgggcgtggacagtggcgccacactcgtg
gccggcggcgacagggcgggcagcagggggttctacatccagccaaccgtctttgcagac
gtcgaggacgaaatgaagatcgcgcaggaggagatattcgggccggtgcagtccatcctc
aagttcagcacggtggaggaggtggtgcggagggcgaacgcgacgccatacgggctggcg
gcgggggtgttcacccagaggctggacgcggcgaacaccctggcgcgggcattgagggtc
gggacggtgtgggtgaacacctacgacgtgttcgacgcggccgtcccgttcggcggctac
aagatgagcggcgttggcagggagaagggcgtctacagcctccgcaactacctccagacc
aaggccgtcgtcacgcccatcaaggacgccgcctggttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336538
Entry
4336538           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 3 member F1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336538
   00053 Ascorbate and aldarate metabolism
    4336538
   00620 Pyruvate metabolism
    4336538
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4336538
   00561 Glycerolipid metabolism
    4336538
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4336538
   00310 Lysine degradation
    4336538
   00330 Arginine and proline metabolism
    4336538
   00340 Histidine metabolism
    4336538
   00380 Tryptophan metabolism
    4336538
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4336538
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4336538
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4336538
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4336538
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4336538
NCBI-ProteinID: XP_015635925
UniProt: Q7XR89 A0A0P0WD38
LinkDB
Position
4:complement(27043974..27048895)
AA seq 499 aa
MGRVAPSVEEVGGEQPPPALGPGETVSGTVAELRAAYESGRTRSLEWRQSQLRGLLRLLA
EEEAAAFRALREDLGKHQAEAYRDEIGVLVKSANAALREVGKWMAPEKVWVPLIAFPARA
QLEPQPLGVILVFSCWNVPLGLSLEPLVGALAAGNAVALKPSELAPATAKFLGDNVGKYM
DATAVKVIQGGPEVGEQLMEHRWDKVLFTGSPRIARVVMAAAAKHLTPVALELGGKCPCI
FDTIGGSARDLQTAVNRVVGGKWSSCAGQACLAIDYVLVEERFVPVLIKALKSTLKKFFA
DSDHMARIVNARHFQRLSDLLKDKSVAASVLHGGTLDAKNLCIEPTILLNPPLDSAIMTE
EIFGPLLPIITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVV
QYGIDSLPFGGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMR
QLYRYNYVGFVLTFLGLKK
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgggaagggtggcgcctagcgtcgaggaggtcgggggcgagcagccgccgcccgcgctt
gggcccggcgagaccgtgagcgggacggtggccgagctgagggcggcgtacgagagcggc
aggacgcggagcctggagtggaggcagtcgcagctccgggggctcctccggctcttggcg
gaggaggaggccgccgcgttccgggcgctccgcgaggacctcggcaagcaccaagccgag
gcctacagagacgagatcggcgtgcttgtcaagtcggcgaacgccgcgctgcgtgaggtc
gggaaatggatggcgccggagaaggtctgggtgccgctaatcgcgttcccggcaagggcg
cagctggagccgcagccgctcggggtcatcctcgtcttctcttgctggaatgtcccgttg
ggcctctctctggagcctctcgttggagcattggcggccggcaatgcggtcgcgctgaag
ccatcggagctggcgccggccaccgctaagttcctcggcgacaacgtcggcaaatacatg
gacgccacggccgtgaaggtcatccagggcgggccggaggttggcgagcagctcatggaa
cacagatgggacaaggtccttttcaccgggagcccgcgcatcgcgcgcgtcgtgatggcc
gcggccgcgaagcacctgacgcccgtggcgcttgagctcggcgggaagtgcccctgcatc
ttcgacacgatcggcggcagcgcgcgggacctgcagaccgcggtgaaccgcgtcgtcggg
ggcaagtggtcgtcctgcgccggccaggcctgcctggccatcgactacgtcctcgtcgag
gagcgcttcgtgcccgtcctgatcaaggcgctcaagtcgacgctgaagaagttcttcgcc
gactcggaccacatggcgcggatcgtcaacgcgaggcacttccagcggctgagtgacctt
ctcaaggacaaatcggtcgcggcgtccgtcctccacgggggcacattggacgccaagaac
ctgtgcatcgagcccacgattctgctgaatcccccactcgactccgcgatcatgacagag
gagattttcggccctctcctgcccatcatcacggtgaagaagatagaggacagcatcgcc
ttcgtgagagcgcggccgaggccgctcgccgtctacgcgttcaccaaaaacgccgcactg
aggcgccgaatcgtcgaggagacgtcgtcggggagcgttacgttcaacgacgcagttgta
caatacgggatcgattcgctgccgttcggcggcgtcggcgagagcggattcgggcagtac
cacggcaagtactccttcgagatgttcagccacaagaaggcggttctgacgagaggatac
cttatcgagctgacggccaggtacccgccgtgggatgacagcaagatctccatgatgcga
cagctctaccgttacaattacgtcggattcgtcttaaccttcctcggtctaaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340725
Entry
4340725           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340725
   00053 Ascorbate and aldarate metabolism
    4340725
   00620 Pyruvate metabolism
    4340725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4340725
   00561 Glycerolipid metabolism
    4340725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4340725
   00310 Lysine degradation
    4340725
   00330 Arginine and proline metabolism
    4340725
   00340 Histidine metabolism
    4340725
   00380 Tryptophan metabolism
    4340725
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340725
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4340725
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4340725
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4340725
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4340725
NCBI-ProteinID: XP_015643334
UniProt: A3BAJ7 Q9FRX7
LinkDB
Position
6:9091021..9096497
AA seq 549 aa
MAAAAARRGSSLLSRCLLSRPAAAASPAVPSALRRADGTQGLLPGILQRFSTAAVAEEPI
SPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAEDINRAVHAARKAFD
EGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAANIEVPMVARLMRYY
AGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLK
TAEQTPLSALFASKLLHEAGLPDGVVNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKV
VLELAARSNLKSVTLELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RIYDEFVEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGD
RLGDKGYYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVF
TNNLNTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVV
TPIKNAAWL
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggctgccgctgctgcaaggaggggctcatcgctgctctctcgctgcctgctgtccagg
cccgccgccgccgcctcgcctgctgtcccctctgcgctccgcagggcagatgggacacaa
ggattgttgccgggaatccttcagaggttcagcactgcagcagtagcagaggagcccata
tcacccccagtccaagtgaactacactcagctcctcattgatggaaaattcgttgattca
gcatctggcaaaactttcccaactctggaccctcgtaccggggagctgattgcccatgtg
gctgaaggcgatgcggaggatattaaccgtgcggttcatgcggcccgcaaggctttcgat
gaagggccatggccaaagatgactgcctatgagagatcccggattctgttgcggtttgct
gacttgattgagaagcacaacgatgaaattgctgcattggagacatgggacaacggcaag
ccgtatgcgcaagctgccaacattgaagtgccaatggtggcacggctgatgcggtactat
gctggttgggctgacaagatccatgggcttgtcgtgccggctgacggcccacaccatgta
caggtgctgcacgagcccattggtgtcgcaggtcagatcatcccatggaactttccgctt
ctgatgtttgcgtggaaagttggccctgctttggcttgtggaaacactgttgtgctcaag
acggctgagcaaactcctctgtctgctctatttgcttctaagctgttgcatgaggctgga
ctcccagacggtgttgttaacgtggtatctggttttggacctactgctggtgctgctctt
gctagtcacatggatgtcgataagattgcattcactggatcgaccgatactggaaaagtc
gtccttgagttggctgcaaggagcaaccttaagtcagtgacactggagctaggaggcaag
tctcctttcatcatcatggatgatgctgatgttgaccatgctgttgagcttgcgcatttt
gcactgttctttaaccagggacaatgttgctgtgctgggtctcgtacatttgtgcatgag
cgtatctatgatgagttcgtggagaaggccaaggctcgtgctctcaagcgtgtggttggt
gatccattcaagaatggtgttgaacagggccctcagattgatgacgagcaattcaacaag
atcttgcgctacatcaagtatggtgttgacagtggagccaaccttgtgactggtggcgac
agattaggtgacaaaggttactacatccagccaacaattttctcggatgtacaggataac
atgaggattgctcaagaagagatatttggccctgtgcagtccattctgaagttcaatgat
ctgaacgaggtcatcaagagggcaaatgcaagccagtacgggctggctgctggggtcttc
accaacaacctgaacacggccaacaccctgacccgcgcgctcagggtcgggaccgtgtgg
gtgaactgcttcgacgtcttcgacgccgcgatcccgttcggcggatacaagcagagcggc
atcgggagggagaagggcatcgacagcctgaagaactacctgcaggtcaaggccgtcgtc
acgccgatcaagaacgccgcgtggttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349966
Entry
4349966           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 3 member H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349966
   00053 Ascorbate and aldarate metabolism
    4349966
   00620 Pyruvate metabolism
    4349966
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4349966
   00561 Glycerolipid metabolism
    4349966
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4349966
   00310 Lysine degradation
    4349966
   00330 Arginine and proline metabolism
    4349966
   00340 Histidine metabolism
    4349966
   00380 Tryptophan metabolism
    4349966
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4349966
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4349966
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4349966
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4349966
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 4349966
NCBI-ProteinID: XP_015617047
UniProt: Q53NG8 B9G9S1
LinkDB
Position
11:4375258..4380039
AA seq 482 aa
MAEEEVAAVVGELRGSFRSGRTRAAEWRAAQLRGIVRMVEEREGDISDALHSDLAKPRME
SYLHEISLAKAACTFALKGLKNWMKPEKVPAALTTFPSTAQIVSEPLGVVLVISAWNYPF
LLSIDPVIGAIAAGNAVVLKPSEIAPATSALFAKLLPEYVDSSCIKVVEGGVPETTALLE
QKWDKIFYTGSGNVGRIVMAAAAKHLTPVALELGGKCPAIVDSNTDLHVTMKRLAVGKWG
CNNGQACIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNL
IEDKKVAQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQ
FINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSY
HGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGFPKE
RR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcggaggaggaggtggcggcggtggtgggggagctgagggggagcttcaggtccggg
aggacgagggcggcggagtggcgggcggcgcagctgcgggggatcgtgaggatggtggag
gagagggagggggacatctccgacgcgctccactccgacctcgccaagcctcgcatggag
tcctacctccacgagatatcattggcaaaggcagcctgcacatttgccttgaaggggttg
aagaattggatgaaacctgagaaggtacctgccgccctcactacattcccatcaactgca
caaattgtgtcagagcctcttggtgtcgtcctagtcatctcagcatggaactaccctttc
ttgctctccatcgacccagtcataggagcaattgctgctgggaatgccgttgtgctgaag
ccatcagaaattgcaccagccacctcagcattgttcgccaagctgctacctgaatacgtt
gatagctcttgcataaaagtggtggagggaggcgttccagaaacaaccgcactcttagaa
caaaagtgggataagatcttctacacaggtagcggaaatgtgggccgcatagtgatggca
gcagctgcaaagcatcttacccctgtggctctagagcttggtggaaaatgccctgcaatt
gttgattctaatactgatcttcatgttaccatgaagaggctagctgttggcaagtgggga
tgtaacaacgggcaggcatgcattgctccagactacgttataacaacaaaatcatttgct
ccagagctggttgactctttaaaaagagttttgaaaaggttctatggggaggatcctttg
caatcagaagacttgtcccgtattgtgaattctaaccatttccgtagattgacaaatttg
atagaggataagaaagtcgcccaaaagattgtatatggtggccaaacagatgagaagcaa
ctaaaaatagctcctactgtgttgttagatgttcctcttgatacaacactcatggcagag
gaaatttttggtcccttacttcccattgtaacagttgacaagattgaagatagcatccag
ttcatcaactcaaggaccaagccacttgcagcctatcttttcaccaaggacaagaaactg
caagaggaatttgtgtccaatgtcccagcaggaggaatgcttgtaaatgatgttgccctg
catctcgccaatccgcacctgccatttggcggagtcggcgacagcgggatcggctcctac
catggcaaattcagcttcgattgtttcacccacaagaaggccgtcctgatccgcggcttc
ggaggggaggcaactgctaggtacccaccttacacgattgagaagcagaagatcctgaga
ggactgataaacggcagcttctttgcactgattcttgccctcctgggcttccccaaagag
aggcgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271186
Entry
9271186           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 3 member H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00770  Pantothenate and CoA biosynthesis
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9271186
   00053 Ascorbate and aldarate metabolism
    9271186
   00620 Pyruvate metabolism
    9271186
  09103 Lipid metabolism
   00071 Fatty acid degradation
    9271186
   00561 Glycerolipid metabolism
    9271186
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    9271186
   00310 Lysine degradation
    9271186
   00330 Arginine and proline metabolism
    9271186
   00340 Histidine metabolism
    9271186
   00380 Tryptophan metabolism
    9271186
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    9271186
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    9271186
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    9271186
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     9271186
SSDB
Motif
Pfam: Aldedh LuxC Tk-SP_N-pro
Other DBs
NCBI-GeneID: 9271186
NCBI-ProteinID: XP_015618174
UniProt: Q2QWY3
LinkDB
Position
12:3946933..3955912
AA seq 484 aa
MAAARSVGMEAEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKP
YTESYVHEIALVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWN
YPFLLSIDPIIGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDGSCIKVVEGGVAETTT
LLEQKWDKIFYTGNGKVGRIVMASAAKHLTPVVLELGGKCPVVVDSNVNLHVTAKRIAAG
KWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRL
KKLMDDENVSDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHE
SFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGM
GAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF
PRGK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcggcggcgaggagcgtggggatggaggcggaggtggcggcgctgcgggggaggttc
gcggcgggggggacgcggggcgcggagtggcgggcggcgcagctccgcgggatcctgcgg
atggcggcggaggcggaggcggaggtgtgccgcgccctccacgccgacctcgccaagccc
tacaccgagtcctacgtccacgagattgcgctggtgaagtcgtcctgcaagtttgccctc
aagaatctgaagaaatggatgaagccccaaaaggtcactgctccgcttatgacgttcccg
tcgacggcgagggtggcggcggagccactcggcgtcgtgctcgtcatctcggcctggaac
taccctttcttgctgtcgatcgacccgatcatcggagcgatcgccgccggcaacgccgtg
gtgctgaagccgtcggaggtggcgccggcgacctcgtcgctgctggccgagctgctgccg
cgctacgtcgacggcagctgcatcaaggtcgtcgagggtggcgtcgccgaaaccaccacc
ctgctcgagcagaaatgggacaagatcttctacacagggaatggcaaggtaggacgcatc
gtgatggcgtcggcggcgaagcacctgacgccggtggtcctggagctcggcggaaaatgc
ccggttgttgtcgactctaatgtcaacctccatgttactgccaagaggatagccgccggg
aaatggggttgcaacaatgggcaggcctgcatttctcctgatttcatcataacaacaaaa
tcattcgccccaaagctgctggaggctctagagaaagttttggagaagttctacgggagg
gacccgctgcgatcatctgacttgtcgcgaattgtgaattccaaccattttaaccggctg
aagaagctgatggacgatgaaaatgtctctgataagatcgtgttcggaggtcagagagat
gaacatcagctaaagatagcccctacaatcttcatggatgttcctcttgattcagggatc
atgaaggaggaaatctttggccccttgcttcctatcataacggttgataagatccatgag
agctttgctctcatcaactccatgacaaaggcacttgcagcctacctcttcaccaaggac
agcaagctccaggaacaatatgaggcagccatctctgcaggaggaatgcttgtcaacgac
acagccgtccacctaacaaaccagtacctaccttttggaggagttggggagagcggcatg
ggagcctaccatggcaggttcagcttcgaggccttcagccacaagaaggccgtgctggtc
cgccgcttcgccggcgaggcggcggcgaggtacccgccgtactcgccggcgaagctcaag
atcctcaggggagtgctcaagggcaacctgggagccatgatcaaggctatcttggggttt
ccaagagggaaatga

DBGET integrated database retrieval system