KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330164
Entry
4330164           CDS       T01015                                 
Name
(RefSeq) glutamate dehydrogenase A
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4330164
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4330164
   00220 Arginine biosynthesis
    4330164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330164
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     4330164
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4330164
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C Bac_GDH
Other DBs
NCBI-GeneID: 4330164
NCBI-ProteinID: XP_015622776
UniProt: Q6H3Y7
LinkDB
Position
2:26240129..26242983
AA seq 411 aa
MNALAATSRNFRQAARLLGLDSKLQKSLLIPLREIKVECTIPKDDGTLATFVGFRVQHDN
SRGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVAAVPYGGAKGGIGCTPGELSRSELERL
TRVFTQKIHDLIGINTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
RDAATGRGVMYATEALLTEYSESISGSTFVIQGLGNVGSWAAKLIHQKGGKIVAVGDVTG
AIRNKSGIDIPALLKHRSEGGSLEDFYGAEVMDAAELLVHECDVLVPCALGGVLNRENAA
EVKARFIIEGANHPTDTEADEILAKKGVIVLPDIYANSGGVVVSYFEWVQNIQGFMWDEE
KVNRELQKYMKNAFQNIKDMCKSQNCNLRMGAFTLGVNRVAKATLLRGWEA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaacgcgctagccgccaccagccgcaacttccggcaggcggcgaggctactcggcctc
gactccaaactccagaagagccttctgatccctctccgcgagatcaaggttgaatgcacc
atccccaaagacgatggcaccttggcgacgtttgttgggttcagagtgcagcatgacaat
tcccgtggcccgatgaaaggcggcatcaggtatcaccctgaggttgacccagatgaagtg
aatgcacttgctcagctgatgacatggaagactgctgttgctgctgtgccttatggtgga
gcaaagggaggcattgggtgcactcctggtgaactgagtagaagtgaacttgagcgttta
acgcgcgtgtttacccagaaaattcatgacctcattgggatcaatacagatgttccagcc
cctgacatgggaacaaatgcacagaccatggcatggatactagatgaatactcaaagttc
catggccactccccagctgttgtcacgggaaagccaattgatcttggaggatccttagga
agagatgctgcgactggccgcggtgttatgtatgctactgaggctttattgactgaatac
agcgagtcaatttcaggatcaacctttgttatccagggtttggggaatgttggttcttgg
gcagccaagctcatccatcagaaaggtggcaagatagttgcagttggagatgtaacaggt
gcaatcagaaataaatccgggatagacatacctgctctcttgaagcacaggagcgagggt
ggatctttggaggacttctacggtgcagaagttatggacgctgcagagctgcttgtgcat
gaatgtgatgttctcgtcccgtgcgccttgggtggtgttctcaacagagaaaatgcagct
gaagtgaaggccagattcataattgagggggctaatcatcccactgatacagaagctgat
gagatactcgcaaagaagggagtcattgtgctgccagatatctatgcaaattcaggcggc
gtggtcgtcagctattttgagtgggttcagaacattcagggcttcatgtgggatgaagag
aaggtgaacagggagctccaaaagtacatgaagaacgcttttcagaacatcaaggacatg
tgcaaatcccaaaactgcaaccttaggatgggggcattcactttgggggttaaccgggtt
gcaaaggctactctgttgaggggatgggaggcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334405
Entry
4334405           CDS       T01015                                 
Name
(RefSeq) glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4334405
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4334405
   00220 Arginine biosynthesis
    4334405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334405
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     4334405
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4334405
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C zf-RING_12 AdoHcyase_NAD Phage_tube_C
Other DBs
NCBI-GeneID: 4334405
NCBI-ProteinID: XP_015631051
UniProt: Q852M0
LinkDB
Position
3:complement(33038055..33043340)
AA seq 411 aa
MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN
ARGPMKGGIRYHHEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCSPGDLSISELERL
TRVFTQKIHDLIGIHTDVPAPDMGTNSQTMAWILDEYSKFHGYSPAVVTGKPVDLGGSLG
RDAATGRGVLFATEALLAEHGKGIAGQRFVIQGFGNVGSWAAQLISEAGGKVIAISDVTG
AVKNSNGLDIAKLMKHSSENRGIKGFDGGDAIDPRSLLTEECDVLIPAALGGVINKDNAN
EIKAKYIIEAANHPTDPEADEILSKKGVLILPDILANSGGVTVSYFEWVQNIQGFMWDEE
KVNNELKTYMTRGFRDVKEMCRSHHCDLRMGAFTLGVNRVARATVLRGWEA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaatgcgttggcagcgacgagcaggaacttcaagcaggcggccaagctgctgggcctg
gactccaagctggagaagagcttgctcatcccgttcagggagatcaaggttgaatgcaca
attccgaaagatgatgggactttagcatcttatgttgggtttagggtccaacacgacaat
gctaggggacctatgaagggtggaatcagataccaccatgaggttgatcctgatgaggtc
aatgcgttggcacaactaatgacatggaagacggccgtggctaatattccatatggagga
gctaaaggtggaataggatgcagccctggagatctcagcatctccgagctagagcgactt
acccgtgttttcacccagaaaatccacgacttgattggcattcatacagatgttccagct
ccagatatgggaaccaactctcagacaatggcgtggatacttgacgaatactcaaagttt
catggttattcacctgctgtggtgactggaaaacctgttgaccttggaggatcacttgga
agagatgcagctactggaaggggagttctgtttgctactgaagccttgcttgcagagcat
ggcaagggcattgctggccagcgttttgtaatacagggatttggtaatgttggatcctgg
gctgctcagctgatcagtgaagctggtggcaaggtgattgccatcagtgatgtcactgga
gctgtcaagaacagcaatgggcttgacattgcaaagctaatgaagcactcatcagagaac
cgcgggatcaagggtttcgacggaggcgatgcaatcgacccacgctcactgcttactgaa
gaatgtgatgtcctcatcccggcagcacttggtggagttataaacaaggacaacgcaaat
gagatcaaagcaaagtacatcattgaggctgcaaaccaccccacagaccctgaggcagat
gagatcctgtccaagaaaggcgttctcattcttccagacatcctcgcgaactccggtggt
gtcacagtgagctacttcgagtgggttcagaacattcagggtttcatgtgggacgaggag
aaggtgaacaatgagctgaagacctacatgacccgtgggttcagggatgtgaaggagatg
tgcaggagccaccactgcgacctccgcatgggcgccttcaccctcggtgtcaaccgtgtc
gctcgcgccaccgttctcagaggatgggaagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336554
Entry
4336554           CDS       T01015                                 
Name
(RefSeq) glutamate dehydrogenase 2
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4336554
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4336554
   00220 Arginine biosynthesis
    4336554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4336554
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     4336554
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4336554
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C zf-RING_12
Other DBs
NCBI-GeneID: 4336554
NCBI-ProteinID: XP_015637000
UniProt: Q33E23
LinkDB
Position
4:27233367..27238183
AA seq 411 aa
MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVAAIPYGGAKGGIGCAPGELSTSELERL
TRVFTQKIHDLIGAHTDVPAPDMGTNSQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
RDAATGRGVMYATEALLAEHGKSISGSTFVIQGFGNVGSWAARIIHEKGGKVIALGDVTG
SIRNKNGLDIPALMKHRNEGGALKDFHDAEVMDSSELLVHECDVLIPCALGGVLNRENAP
DVKAKFIIEAANHPTDPEADEILAKKGVTILPDIYANSGGVIVSYFEWVQNIQGFMWDEE
KVNMELHKYMNNSFQHIKAMCKSHDCNLRMGAFTLGVNRVARATLLRGWEA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaacgcgctcgccgccaccagccgtaacttccggcaggccgccaggctgctcggcctc
gactccaagctcgagaagagcctcctgatcccgttccgcgagatcaaggtggaatgcacc
atccccaaagacgatggaaccttggcgtccttcattgggttccgcgtgcagcacgacaat
gcccgcgggccaatgaaaggtggcattcgctatcaccctgaggttgatccagatgaagta
aatgcacttgctcaactaatgacatggaagactgctgttgcagcaattccatatggtgga
gcaaagggtgggattggatgcgctcctggtgaattaagcacgagtgagctggagcgtttg
acacgtgtatttacacagaaaattcatgatcttattggagctcatactgacgtgccagct
cctgacatgggaactaattcacagaccatggcttggattttggatgagtactcgaaattc
catggtcattcaccggcagttgtcactgggaagccaatagatcttggtggatcattaggt
agagatgctgctacaggaagaggtgtgatgtacgctactgaggctcttttggctgaacat
ggaaagtccatttctggatcaacctttgttatccagggttttggtaatgttggttcatgg
gctgcacgaatcatccatgagaagggtggcaaggtgattgcacttggagatgtgacaggc
tcaatcagaaacaagaatgggttagacatacctgctctgatgaagcacagaaatgagggt
ggtgctttgaaagattttcatgatgcggaagtcatggattcttcagagctactagtgcat
gaatgcgatgttctcatcccatgcgctttaggtggagtgctcaacagggaaaatgcacct
gatgtgaaggccaaatttataattgaagctgctaatcatccaactgatccagaagctgac
gagattcttgccaagaagggagtgaccatattacctgacatttacgccaactccggtggt
gtgatcgttagctattttgagtgggttcagaacattcaagggttcatgtgggatgaggag
aaggtgaacatggagctccacaagtacatgaacaattctttccagcacatcaaggccatg
tgtaaatctcatgattgcaacctgaggatgggggcgttcaccctgggagtcaaccgggtt
gcacgtgccaccctcttgaggggatgggaggcatga

DBGET integrated database retrieval system