KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330198
Entry
4330198           CDS       T01015                                 
Name
(RefSeq) ceramide kinase isoform X2
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4330198
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     4330198
SSDB
Motif
Pfam: DAGK_cat CERK_C
Other DBs
NCBI-GeneID: 4330198
NCBI-ProteinID: XP_015627473
UniProt: C0LT23
LinkDB
Position
2:complement(26504099..26515223)
AA seq 607 aa
MEGGGEALFLDGVGEVTVAVGDDGLSFQPLHQEVSSSCWSSIIMQPKLESKLKFSDVYAV
ELLEVGPVCEPWNARATVQGKINTEMNRFVIHTVTRPRKRPSPWVPCEYIFGHKDQQTCK
TWVEHIKTCINKEQDRPKSLMVFVHPLCGKGRGCKNWETVAPLFERAKVKTKVIVTQRAG
HAYDTLASLSDKDLKKFDGVIAVGGDGLFNEILNGLLSTRHTNSYPPTPEGFGYFRNNMK
CQEHRNNDLSNSELTGDDANAISGSSNTPDDHEPLLSTTRSTGLDISSSDSSDEPCNGDQ
VPLVSFPNNWFRLGIIPSGSTDAIVLSTTGERDPVTSALLIILGRRISLDIAQVVRWKSS
PSAEVSPTVRYAASFAGYGFYGEVIRESEKYRWMGPARYDFSGTMVFLKHRSYEAKVAFL
ENGNTHSLTASAENNANGVQTLQYHQNRHRKTICRTNCLICKGTSTSEQNSEDENPDSSR
TACETPKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLW
HLTQFTKKGSDPLSFKFVEHHKTQAFTFISSHDESVWNLDGELLQACEVSVQAFRGLVNL
FASGPEV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggaaggcggcggcgaggcgctcttcctggacggcgtcggggaggtcacggtggccgtc
ggcgacgacggcctctccttccagccccttcaccaggaagtgagttcttcatgttggtca
tctatcataatgcaacctaagttagagagcaagcttaagttttcagatgtctatgctgta
gagcttcttgaggtgggtcctgtatgtgaaccttggaatgcaagagctaccgttcaaggc
aagataaatactgagatgaaccgatttgtcatacacacggtcacaagaccaagaaaaaga
ccatctccatgggtaccttgtgaatatatttttggtcataaagaccagcaaacctgcaaa
acttgggtggagcatataaagacgtgcataaataaggaacaggataggcccaagagcctc
atggtatttgtccatccattgtgtggaaaaggtagagggtgtaagaattgggaaacagta
gctccattatttgagcgggcaaaagtaaaaacgaaggtgatagtcacacagcgagcagga
catgcatatgatactttagcatctttatcagataaagatctcaagaaatttgatggtgtt
attgcagtgggtggtgatggtttatttaatgaaattttgaatgggctactaagtacaagg
cacacaaattcttatcctccaactccagaagggtttggatatttcagaaacaacatgaag
tgtcaagaacatagaaataatgatctaagcaatagtgagctcacaggagatgatgcaaat
gccatctctggaagttctaacacacctgatgatcatgagccccttctttcaaccacacga
tctacaggattggacatctcgtcatcagattctagtgatgaaccatgcaatggagatcag
gtgcctttagtctccttcccaaataattggtttaggcttggaataattccttctggctca
acggatgctattgttctcagtacaactggggagcgagatcctgtgacttctgctctgctt
attatcctcggcagaaggatatcacttgatatagctcaagttgtcagatggaaaagtagc
ccatcagctgaggtttcaccaactgtgcgctatgctgcttcgtttgcaggatatggattt
tatggagaagttataagggagagtgaaaagtacaggtggatgggtcctgcgcgatatgac
ttctctggaacaatggtatttttgaagcacagatcttatgaggcaaaagtggcttttctt
gaaaatggaaacactcattcacttacagcatcggcagagaataatgcaaatggagtccaa
acactgcaataccatcaaaatagacatcggaaaaccatctgccgaacaaattgtttaata
tgcaaaggaacttcaacatctgaacagaattcagaagatgaaaatccagacagttccaga
acagcttgtgagaccccaaaatgggtctggtccaagggtcgttttctcagtgttggtgca
gctgtcatttcatgtcgtaacgaaagagcccctgatggtctagtagctgacgcacaccta
tctgatggttttcttcatcttctgctcattagagattgccctcttcccttttacttatgg
catctaacacaatttaccaagaagggctcagatcctctgagcttcaagtttgtcgaacat
cataagacacaagcatttacttttatatcgtcacatgacgaaagtgtctggaacttggac
ggagaacttcttcaggcctgtgaggtatctgttcaagctttccgaggccttgtcaacctc
tttgcgtcaggaccggaggtgtag

DBGET integrated database retrieval system