KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330214
Entry
4330214           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4330214 isoform X1
  KO
K08497  protein transport protein SEC20
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4330214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330214
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    4330214
SSDB
Motif
Pfam: Sec20 Elongin_A DUF4407
Other DBs
NCBI-GeneID: 4330214
NCBI-ProteinID: XP_015623272
LinkDB
Position
2:complement(26663287..26667689)
AA seq 293 aa
MSVMVHSDIRMDKVTQAVENLKEEWNQAVAQLEGCIAAIESCGKMGKGTEEASSLPRLNG
SAQDALQLLNSLQCRLDPLAEQLPTFEEVQSGQATLQSWKEQYQKLRMRLRNANLQANAN
IKKAAQEERELLLGGGEESTIRRRNLQTKAGMTSAAESITESLRRSRQLMVQEVERSANT
LATFDESTSVLRKAEGEYQGHRSLLMRTRGLLSTMQRQDVLDRIILTIGFLIFSLAVLYV
VSRRIGLLTLQRKLADAIRSGSISAEDVVAKVKNVPVPAPAAPAPAPPIYDEL
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtctgtgatggtccattcagatattaggatggataaggtgactcaagctgttgagaac
ctaaaggaggaatggaatcaagctgttgcacagcttgaagggtgcattgctgcaattgaa
tcatgtgggaagatgggaaaggggacagaggaagcaagttcacttcctaggttaaacggt
tctgcacaggatgcactgcaattgctcaattcactacagtgcagacttgatcctctggca
gagcagctacccacttttgaagaagtacagtctggccaagcaaccctgcagtcatggaag
gaacagtatcagaagctgcgcatgaggctgagaaatgctaacttacaagcaaatgcaaac
attaaaaaagctgctcaagaagagagggagcttcttctagggggtggagaagaatctacc
atccgcaggcgtaatctacagacaaaggctgggatgacatcggctgcagaaagtataacc
gagagcctccgccgatctcgccagttgatggtccaggaagtggaaagaagtgcaaatacc
ttggcaacatttgatgaatcaacaagtgttcttcgtaaggctgaaggtgaatatcaagga
caccgctctttgctgatgcgtactcgtggtttgctatctacaatgcaacggcaagatgtt
cttgataggatcatccttaccattggttttctcattttctccttggcggtgctatatgtt
gtctcgagacgtattggcctgttgacactgcaaaggaagctggccgatgccatcagatca
ggctcaatatcagctgaagacgttgtagcaaaagtcaagaatgtgcctgtcccagcacct
gctgctcctgctcctgctcctcctatttatgatgaactatga

DBGET integrated database retrieval system