KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330220
Entry
4330220           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis protein 19-1
  KO
K13337  peroxin-19
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4330220
SSDB
Motif
Pfam: Pex19 DUF445 PA_decarbox Fib_alpha Ribosomal_L12 Ndr
Other DBs
NCBI-GeneID: 4330220
NCBI-ProteinID: XP_015623293
UniProt: A0A0N7KFT8
LinkDB
Position
2:complement(26762843..26766488)
AA seq 260 aa
MASSNPGAGDELLDELLDSALDDFTSLDLSAAPKSGGEASAASSSSSGSGDAKPVKGLGL
GLGLPDPRAPRRRAAKQPTAAPPPLPPRGAYASEALEKLTRETREAVRGLETATGAIAGL
DDDAMMEEFVKQFEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEENKSK
ISKEEYERYNNQLELMMKLNEVYEKEPENMAKIFEIMQNMQECGQPPSDLVQDIAPDLDL
SKLGQLSPEMLESAPNCCVM
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcctcctccaaccccggcgccggcgacgagctcctcgacgagctcctcgacagcgcc
ctcgacgacttcaccagcctcgacctctccgccgcccccaaaagcggcggggaggcctcg
gcggcgtcgtcgtcgtcatcggggtcgggggacgcgaagccggtgaaggggctggggctg
gggctggggctgccggaccccagggcgccgaggcggcgggcggcgaagcagcccactgcc
gcgccgccgccgctgccgccgaggggcgcgtacgcgtcggaggcgctcgagaagctgacg
cgcgagacgcgggaggcggtgcgcgggctcgagacggccaccggggccatagcggggctg
gatgacgatgcgatgatggaggagttcgttaagcagttcgaggagttcgccggcgcgcag
gatatggactccattgttgaaacaatgatgcaacaacttctatccaaggagattcttcat
gagccgatgaaggacattgtggaaaaatacccaaaatggctcgaggaaaataaaagcaaa
ataagcaaagaagaatatgagcgttacaacaaccagcttgaactcatgatgaagcttaat
gaggtctacgaaaaggagccggaaaacatggcaaagatttttgagatcatgcaaaacatg
caagaatgtggtcaaccccccagtgatcttgttcaagacattgctccagatcttgatctg
agcaagttgggacaactgtctccggagatgcttgaatcagcaccaaattgctgtgtaatg
tga

DBGET integrated database retrieval system