KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330260
Entry
4330260           CDS       T01015                                 
Name
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4330260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4330260
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     4330260
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     4330260
    2.5.1.29  geranylgeranyl diphosphate synthase
     4330260
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4330260
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 4330260
NCBI-ProteinID: XP_015626863
UniProt: Q6ET88 A0A0P0VMU3
Structure
LinkDB
Position
2:complement(27120990..27124478)
AA seq 342 aa
MALSSFSMSLPFAKLPSTSKSTRFLPIRASSAAAAASPSFDLRLYWTSLIADVEAELDAA
MPIRTPERIHSAMRYAVLPGAGNEGTAKRAPPVLCVAACELLGAPREAALPAAVALEMLH
AASLVHDDLPCFDAAPTRRGRPSTHAAYGTDMAVLAGDALFPLAYTHVIAHTPSPDPVPH
AVLLRVLGELARAVGSTGMAAGQFLDLAGATALGEAEVMKVLTKKFGEMAECSAACGAML
GGAGPDEEAALRRYGRTIGVLYQLVDDIRSASGNGKMRSNASVLRALGMDRALGIVEELK
AQAKMEADRFGDKYGERVLPLYSFVDYAVERGFELQDAATTP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggctctctcctccttctccatgtccctccccttcgccaagctgccttccacctccaaa
tccacccgcttccttcccatccgggcctcctctgccgccgccgccgcctccccttccttc
gatttgcgcctctattggacatccctgatcgccgatgtggaggccgagctcgacgccgcg
atgcccatccgcacgccggagagaatccactccgccatgcgctacgccgtcctcccgggc
gccggcaacgagggcaccgccaagcgcgcgcccccggtcctctgcgtcgccgcctgcgag
ctcctcggcgcgccgcgcgaggccgcgctccccgccgctgtggccctcgagatgctccac
gcggcgtcgctcgtgcacgacgacctcccatgcttcgacgccgcgcccacccgccgcggg
cgcccctccacccacgccgcctacggcaccgacatggccgtcctcgccggggacgcgctc
ttccccctcgcctacacccacgtcatcgcccacactccgtcgcccgaccccgtaccccac
gccgtcctcctccgcgtcctcggggagctagcgcgcgccgtgggatccacaggcatggcg
gccggccaattcctcgacctcgccggcgccaccgccctcggcgaggccgaggtcatgaag
gttctgacgaagaagttcggcgagatggcggagtgctccgccgcctgcggcgccatgctg
ggaggcgcggggcccgacgaggaggccgcgctgcggcgctacggccgcaccatcggcgtc
ctgtaccagctcgtcgacgacatccggagcgcgtcgggcaacggcaagatgaggagcaat
gccagcgtcctgcgcgcgctgggcatggatcgagcgctcggcatcgtagaggagctcaaa
gcgcaggccaagatggaggccgacaggttcggtgacaagtatggcgaaagggtgcttccc
ttgtacagcttcgtggactatgcggtggagaggggattcgagctgcaggatgcagctaca
acgccgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343721
Entry
4343721           CDS       T01015                                 
Name
(RefSeq) geranylgeranyl pyrophosphate synthase 7, chloroplastic
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4343721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4343721
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     4343721
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     4343721
    2.5.1.29  geranylgeranyl diphosphate synthase
     4343721
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4343721
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 4343721
NCBI-ProteinID: XP_015647986
UniProt: Q7XI92 Q0D557
Structure
LinkDB
Position
7:complement(23506851..23509310)
AA seq 366 aa
MAAFPPLAASRVRISPLIPAAAMAGTAGAAAASYAQHRRRFCAIVATAAASPVPAAAAAA
ATGFDFNAYMGEKAAAVNRALDASIPADEPPAALHEAMRYALLAGGKRVRPALCLAACAV
VGGREAWAMPAAAAVEMVHTMSLVHDDLPCMDDDDLRRGKPTCHVVYGEPIAVLTGDALL
SLSFHHMARFDSYPPDIDADKHPARVVRAIGELARCIGSEGLVAGQVVDLEMTGSTETVP
LERLEYIHLHKTAALLEASVVIGAILGGGSDEQIESLRMYARSIGLLFQVVDDILDVTKS
SEELGKTAGKDLASDKTTYPKLLGLEKSREFAEKLLSDAREQLSGFDQETAAPLLHLANY
IAYRQN
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggctgccttccccccgctcgccgcctcccgcgtccgcatctcccctctcatccccgcc
gccgcgatggctgggacagcaggggcggcggcggcgtcgtacgcgcagcaccggcggagg
ttctgcgccatcgtggcgaccgcggcggcgtcaccggtgccggccgcggcggcggcggcg
gcgacggggtttgattttaacgcgtatatgggtgagaaggctgcggcggtgaaccgggcg
ctggacgcgtcgatcccggcggacgagccgcccgcggcgctccacgaggcgatgcggtac
gcgctgctggcgggcgggaagcgggtgcggcccgcgctgtgcctggcggcgtgcgcggtg
gtcggggggcgggaggcctgggcgatgcccgccgccgccgccgtcgagatggtgcacacc
atgtcgctcgtccacgacgacctcccctgcatggacgacgacgacctccgccgcgggaag
cccacctgccacgtcgtctacggggagcccatcgccgtgctcaccggcgacgcgctgctc
tccctctccttccaccacatggccaggttcgactcctaccctccggacatcgacgctgac
aagcaccccgcccgcgtcgtccgcgccattggcgagctcgcgcgctgcataggctccgag
ggcctagtcgccggccaggttgttgatcttgagatgactggatcgaccgaaactgtacct
cttgaacgtcttgagtacatccatctccacaaaactgctgcattgcttgaggcatcagtg
gttattggggcaatcttgggaggtggctctgatgagcagattgaaagtttgcgcatgtat
gcgagatcgataggattgttgttccaggttgttgatgatatacttgatgtgaccaagtct
tctgaggagctcggcaagacagcagggaaggacttggcgagtgacaagacgacatacccg
aaattacttgggctggagaaatcacgggagtttgcagaaaagttgctttctgatgcaagg
gaacaactttcaggatttgatcaagagaccgcagcaccacttctgcacctggccaattat
attgcctatcggcagaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272383
Entry
9272383           CDS       T01015                                 
Name
(RefSeq) geranylgeranyl pyrophosphate synthase 7, chloroplastic
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9272383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    9272383
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     9272383
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     9272383
    2.5.1.29  geranylgeranyl diphosphate synthase
     9272383
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   9272383
SSDB
Motif
Pfam: polyprenyl_synt UbiA
Other DBs
NCBI-GeneID: 9272383
NCBI-ProteinID: XP_015614164
UniProt: C7IXE8 Q7F7D7
LinkDB
Position
1:8191051..8192462
AA seq 376 aa
MHVLAQSTAVAKVAASGCLRRSPNPSVTFQRSPSLLLSPAACRRRCRRGCSVSVDVRCSL
GAMVTPELNGGDVGVGVGGGSFDFQRYLSARADAVHDALDRAMPRGFPERLCESMRYSVL
AGGKRVRPVLALAACELVGGDAAAATPVACAVEMIHTMSLIHDDMPCMDDDALRRGRPSN
HVAFGEFTALLAGDALHALAFEHVARGCGDHGVPADRTLRAVAELGSASGTGGVAAGQVA
DKESEGLPVSLAMLEYIHVHKTARLLEAAAVSGAIVGGGADAEVERVRRYARCVGLLFQV
VDDVLDMTSTSEQLGKTAGKDVEADKATYPKLLGVDKAREYAADLLAMAEAELDGFDAER
AAPLRHLARFIAYRQH
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcacgtcctcgctcaatccacggccgtggccaaggtcgccgcctccggctgcctccga
cgaagcccgaacccctccgtgacgttccagagatccccttcccttcttctctcgccggcc
gcgtgccgccgccgctgccgccgcgggtgctccgtctccgtcgacgtgaggtgctccctg
ggcgccatggtcacgccggagctgaacggcggcgacgtcggcgtcggcgtcggcggtggt
agcttcgactttcagcggtatctgtctgccagggccgacgccgtgcacgacgcgctggac
cgggccatgccgcgcggcttcccggagcggctctgcgagtccatgcgctactccgtcctc
gccggcggcaagcgggtgcgccccgtgctcgcgctggccgcgtgcgagctcgtcggcggg
gacgccgcggcggccacgcccgtcgcctgcgcggtcgagatgatccacaccatgtcgctc
atccacgacgacatgccgtgcatggacgacgacgccctccgccggggccgcccctccaac
cacgtcgccttcggcgagttcaccgccctcctcgccggcgacgcgctccacgccctcgcg
ttcgagcacgtggcgcgcggctgcggcgaccacggcgtccccgcggaccgcacgctccgg
gcggtcgccgagctcgggagcgcctcgggcaccggcggggtcgccgccgggcaggtcgcc
gacaaggagagcgagggcctccccgtcagcctcgccatgctggagtacatccacgtgcac
aagacggcgaggctcctcgaggccgccgccgtgtccggcgccatcgtcggcgggggcgcg
gacgccgaggtggagagggtccggcggtacgcgcgctgcgtcgggctcctcttccaggtg
gtcgacgacgtgctcgacatgacgagcacatcggagcagctcgggaagacggccgggaag
gacgtcgaggccgacaaggccacttacccgaagctgctcggcgtcgacaaggcccgcgag
tacgccgccgacctcctcgccatggccgaggcggagctcgacgggttcgacgccgagcgc
gccgcgccgctgcgacacctcgcgcggttcatcgcctacaggcagcattaa

DBGET integrated database retrieval system