KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330302
Entry
4330302           CDS       T01015                                 
Name
(RefSeq) lysophospholipid acyltransferase 2
  KO
K13519  lysophospholipid acyltransferase [EC:2.3.1.51 2.3.1.23 2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4330302
   00564 Glycerophospholipid metabolism
    4330302
   00565 Ether lipid metabolism
    4330302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4330302
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     4330302
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4330302
    2.3.1.-
     4330302
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4330302
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 4330302
NCBI-ProteinID: XP_015626464
UniProt: A0A0P0VMV6
LinkDB
Position
2:27559210..27566963
AA seq 459 aa
MGLEMEGMAAAIGVSVPVLRFLLCFAATIPTGLMWRAVPGAAGRHLYAGLTGAALSYLSF
GATSNLLFVVPMAFGYLAMLLCRRLAGLVTFLGAFGFLIACHMYYMSGDAWKEGGIDATG
ALMVLTLKIISCAINYSDGMLKEEGLRDAQKKYRLAKLPSLIEYFGYCLCCGSHFAGPVY
EMKDYLEYTERKGLWASPTPSPLLPTLRALVQAGACMGLYLYLSPQFPLSRFSEPLYYEW
GFWHRLFYQYMSGFTARWKYYFIWSLSEAAIIISGLGFSGWSDSSPPKAKWDRAKNVDVL
GVELATSAVQLPLMWNIQVSTWLRYYVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGY
IIFFVQSALMINGSKVIYRWQQAVSNPVFHAILVFVNFSYTLMVLNYSCIGFQVLSFKET
LASYQSVYYIGTIVPIVVVLLGYVIKPARPVKPKARKAE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggggctggagatggaggggatggcggcggcgatcggcgtgtcggtgcccgtgctccgc
ttcctgctctgcttcgcggccaccatcccgacgggcctcatgtggcgggcggtgcccggc
gccgcggggcggcacctctacgcggggctcaccggcgccgcgctttcctacctctcgttc
ggggccacatccaacctcctcttcgtcgtgcccatggcgttcgggtacctcgccatgctc
ctctgccgccggctcgcggggctcgtcaccttcctcggcgccttcggcttcctcatcgca
tgtcacatgtactacatgagtggagatgcatggaaggagggtggcattgatgcaacaggt
gctttaatggttttaacattgaaaatcatttcatgtgcaataaactacagtgacggtatg
ttgaaggaagagggtttgcgtgatgcccagaaaaagtatcgtttggctaaacttccttct
ttgatcgaatattttggctactgcctctgctgtggcagccattttgctgggccagtatat
gagatgaaagattatcttgaatatactgaacggaaaggattatgggccagcccaactcct
tcaccactattgcctactttgcgtgctctagttcaagctggcgcatgtatggggttatat
ttgtatctatcacctcaatttccactttcacggtttagcgagcccttatattatgagtgg
ggtttctggcaccggctcttctatcagtacatgtcaggctttactgctcgttggaaatac
tactttatatggtcactttcagaagctgcaatcattatatctggtctgggttttagcggc
tggtctgattcatctcccccgaaagccaaatgggatcgtgcaaaaaatgttgatgtttta
ggtgtcgaattagctacaagtgcagttcagttgccgcttatgtggaacattcaagtgagc
acatggctgcgatactatgtttatgagaggttagttcagaaaggaaagaaacctggtttc
ctccagttgctgggtacacagacagtcagtgctgtctggcatggtctttatcccggatat
atcatattctttgttcaatcagcattgatgataaatggttcaaaagtcatatacagatgg
caacaagcagtcagcaatccagtcttccacgctatcctggtttttgtaaatttttcatac
accttgatggtccttaactactcatgtattgggttccaggtactgagcttcaaggaaacc
ctagcatcctaccagagcgtatattatatcggcacaattgttcccattgtagttgtcttg
ctgggttatgttatcaagccagccaggccagtgaagccaaaggctcggaaggcagaatga

DBGET integrated database retrieval system